Antibodies
- Сортировать:
- Вид таблицей
-
Anti-LAIR1 antibody produced in rabbit
MDL number: MFCD02263578 Human Protein Atlas Number: HPA011155 Human Protein Atlas characterization data
Кат. номер HPA011155-100UL HPA011155-25UL General descriptionLeukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) is a transmembrane glycoprotein which is a part of the leukocyte receptor complex (LRC)-encoded family. In its cytoplasmic domain, it contains two immunoreceptor tyrosine-based inhibition motifs (ITIMs). It is widely expressed on immune cells such as B cells, T cells, natural killer (NK) cells, monocytes, dendritic cells and CD34+ hematopoietic progenitor cells. LAIR-1 gene maps to human chromosome 19q13.4, and codes for a type I transmembrane protein, consisting of 287 amino acids. It has one C2-type Ig-like domain in its exoplasmic region. This gene contains 10 exons, and alternative splicing gives rise to many isosforms such as, LAIR-1a, LAIR-1b, LAIR-1c and LAIR-1d.ImmunogenLeukocyte-associated immunoglobulin-like receptor 1 precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) suppresses the cytotoxic activity of natural killer (NK) cells, and also inhibits the differentiation of blood precursor cells into dendritic cells. It interacts with CD3 and prevents the cytotoxicity of effector T-cells. It cross links with B-cells, and prevents B-cell receptor (BCR)-induced calcium mobilization, as well as inhibition of immunoglobulin (Ig) and cytokine production. It inhibits protein kinase B (PKB) activation and granulocyte-macrophage colony-stimulating factor (GM-CSF)-dependent proliferation of leukemia cells. It might be involved in the regulation of immune response by extracellular matrix (ECM), by interacting with collagen, which leads to suppression of immune response. In rheumatoid arthritis (RA) patients, LAIR-1 is expressed on macrophages of inflamed synovial tissue. It prevents osteoclastogenesis, which might be useful for designing therapy for RA. It is also involved in the proliferation and invasion of epithelial ovarian cancer cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72187,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
recombinant expressionapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH conjugate unconjugated UniProt accession no. Q6GTX8, shipped in wet ice storage temp. 20°C Gene Information human ... LAIR1(3903)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LALBA antibody produced in rabbit
Human Protein Atlas Number: HPA029856 Human Protein Atlas characterization data
Кат. номер HPA029856-100UL HPA029856-25UL General descriptionThe gene LALBA (α-lactalbumin) is mapped to human chromosome 12q13. It is a small acidic calcium-binding milk protein. LALBA constitutes about 20-25% of total protein in human milk. The protein has a helical α-domain and a β-sheeted β-domain.Immunogenlactalbumin, alpha- recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Anti-LALBA antibody produced in rabbit has been used in western blotting and immunohistochemistry.
Biochem/physiol Actions
LALBA (α-lactalbumin) is part of the lactose synthase complex and is responsible for the biosynthesis of lactose. Peptides generated after partial digestion of this protein have antimicrobial and immunostimulatory properties. A multimeric α-lactalbumin enhances cell death in tumors.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77903,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:1000-1:2500 immunogen sequence QVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEK conjugate unconjugated UniProt accession no. P00709, shipped in wet ice storage temp. 20°C Gene Information human ... LALBA(3906)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LAMA1 antibody produced in rabbit
Human Protein Atlas Number: HPA032110 Human Protein Atlas characterization data
Кат. номер HPA032110-100UL HPA032110-25UL Immunogenlaminin, alpha 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77711,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:500- 1:1000 immunogen sequence TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS conjugate unconjugated UniProt accession no. P25391, shipped in wet ice storage temp. 20°C Gene Information human ... LAMA1(284217)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LAMA4 antibody produced in rabbit
Human Protein Atlas Number: HPA015693 Human Protein Atlas characterization data
Кат. номер HPA015693-100UL HPA015693-25UL ImmunogenLaminin subunit alpha-4 precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Laminin subunit α-4 (a component of laminin-8/9) is a protein encoded by the LAMA4 gene in humans. It is found to be expressed in basement membranes of endothelial cells, the peripheral nerves, and muscle fibers. It interacts with syndecan-2 and/or -4 thereby playing a crucial role in cell adhesion and vessel wall formation in skin. In hepatocelluar carcinoma (HCC), it is up-regulated on both mRNA and protein levels and plays a role in hepatocarcinogenesis and tumor progression. This gene may act as a marker for HCC diagnosis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72590,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence ENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQAAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVNSARDAVRNLTEVVPQLLDQLRTVEQKRPAS conjugate unconjugated UniProt accession no. Q16363, shipped in wet ice storage temp. 20°C Gene Information human ... LAMA4(3910)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LAMB1 antibody produced in rabbit HPA004132-100UL
Human Protein Atlas Number: HPA004132 Human Protein Atlas characterization data ImmunogenLaminin subunit β-1 precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86807,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence NQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGG conjugate unconjugated UniProt accession no. P07942, shipped in wet ice storage temp. 20°C Gene Information human ... LAMB1(3912)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LAMC1 antibody produced in rabbit
Human Protein Atlas Number: HPA001909 Human Protein Atlas characterization data
Кат. номер HPA001909-100UL HPA001909-25UL General descriptionLaminin is a large 900kDa complex mosaic glycoprotein synthesized by a range of cells and is deposited in basement membranes. LAMC1 (laminin subunit γ-1) is a component of laminin. It contains a cysteine-rich repeat and a globular region. LAMC1 is associated with various biological functions such as cell attachment, mitogenesis, migration, and cell differentiation. It is upregulated in high-grade serous carcinomas (HGSCs).ImmunogenLaminin subunit γ-1 precursor recombinant protein epitope signature tag (PrEST)ApplicationAnti-LAMC1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86216,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human, mouse packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS conjugate unconjugated UniProt accession no. P11047, shipped in wet ice storage temp. 20°C Gene Information human ... LAMC1(3915)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LAMC3 antibody produced in rabbit
Human Protein Atlas Number: HPA022814 Human Protein Atlas characterization data
Кат. номер HPA022814-100UL HPA022814-25UL Immunogenlaminin, gamma 3ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86464,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence CLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTAGPHCERCQENFYHWDPRMPCQPCDCQSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFHSLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEG conjugate unconjugated UniProt accession no. Q9Y6N6, shipped in wet ice storage temp. 20°C Gene Information human ... LAMC3(10319)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-Lamin A/C Antibody, clone 2B10 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1054-4X25UL ZRB1054-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 2B10 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Lamin A/C. It targets an epitope within the C-terminal half.ImmunogenHis-tagged recombinant fragment corresponding to 183 amino acids from the C-terminal half of human Lamin A/C.ApplicationAnti-Lamin A/C, clone 2B10 ZooMAb®, Cat. No. ZRB1054, is a recombinant Rabbit monoclonal antibody that specifically targets Lamin A/C and is tested for use in and Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Lamin A/C in A431 cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected Lamin A/C in MCF-7, NIH3T3, and L6 cell lysates.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected Lamin A/C in human cerebral cortex tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Lamin A/C in HeLa, A431, HepG2, and NIH3T3 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Prelamin-A/C (UniProt: P02545) is encoded by the LMNA (also known as LMN1) gene (Gene ID: 4000) in human. It is cleaved into Lamin-A/C (also known as 70 kDa Lamin, Renal carcinoma antigen NY-REN-32). Lamins are components of the nuclear lamina that provide a framework for the nuclear envelope and may also interact with chromatin. Lamin A and C are present in equal amounts in the lamina of mammals. Plays an important role in nuclear assembly, chromatin organization, nuclear membrane and telomere dynamics. Lamin A is initially synthesized as prelamin A that undergoes several modifications in the carboxyl terminal region that allow incorporation of prelamin A into the nuclear envelope and its subsequent processing into the mature lamin A. Cleavage of 15 residues (aa 647-662) by ZMPSTE24/FACE1 generates the final protein product. Unlike mature lamin A, prelamin A accumulates as discrete and localized foci at the nuclear periphery. Prelamin-A/C can accelerate smooth muscle cell senescence. It can act to disrupt mitosis and induce DNA damage in vascular smooth muscle cells (VSMCs), leading to mitotic failure, genomic instability, and premature senescence. Mutations in LMNA gene are known to cause Emery-Dreifuss muscular dystrophy that is characterized by weakness and atrophy of muscle without involvement of the nervous system. Some mutations have also been linked to familial type of lipodystrophy characterized by the loss of subcutaneous adipose tissue in the lower parts of the body. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Casasola, A., et al. (2016). Nucleus 7(1); 84-102).
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 2B10, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt ~ 74.14 and 65.13 kDa, observed mol wt ~75 and 65 kDa species reactivity human, mouse, rat packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Lamin B1 Antibody, clone 6K22, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1143-25UL ZRB1143-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,ImmunogenHis-tagged recombinant fragment corresponding to 137 amino acids from the C-terminal region of human Lamin B1.ApplicationAnti-Lamin B1, clone 6K22 ZooMAb, Cat. No. ZRB1143, is a recombinant rabbit monoclonal antibody that specifically targets Lamin B1 and has been tested for use in Immunocytochemisry, Immunohistochemistry (Paraffin), and Western Blotting.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Lamin B1 in HUVEC and HeLa cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected Lamin B1 in human kidney and mouse kidney tissue sections.
Note: Actual optimal working dilutions must be determined by the end user as specimens and experimental conditions may vary.
Target description
Lamin B1 (UniProt: P20700) is encoded by the LMNB1 (also known as LMN2, LNMB) gene (Gene ID: 4001) in human. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family proteins make up the matrix and are highly conserved. They are components of the nuclear lamina that provides a framework for the nuclear envelope. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Two types of lamins, A and B, exist in vertebrates. Type B lamins, B1 and B2, are present in all types of cells. Type A lamins are expressed only following gastrulation. Lamin A and C are the most common A-type lamins, they are both encoded by the LMNA gene and produced by alternative splicing. Lamin B1 is a homodimeric protein that is synthesized with a short propeptide (aa 584-586), which is removed in the mature form. The nuclear localization signal of Lamin B1 is localized to amino acids 415-420. Mutations in LMNB1 gene are reported to cause demyelinating Leukodystrophy that leads early autonomic abnormalities, pyramidal and cerebellar dysfunction and later symmetric demyelination of the CNS. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose. Normal appearance is a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 6K22, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 66.41 kDa, observed mol wt ~66 kDa species reactivity human, mouse packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable (peptide) isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Laminin 2 Antibody, clone 2I22 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1023-4X25UL ZRB1023-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 2I22 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Laminin subunit alpha-2. It targets an epitope within 18 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 18 amino acids from the N-terminal region of human Laminin 2 alpha.ApplicationAnti-Laminin a2, clone 2I22 ZooMAb, Cat. No. ZRB1023, is a recombinant Rabbit monoclonal antibody that specifically targets Laminin 2 and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blo
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected Laminin 2 in human heart tissue sections.
Affinity Binding Assay: A representative lot of this antibody bound Laminin 2a peptide with a KD of 1.0 x 10-8 in an affinity binding assay.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Laminin 2 in AC16 and C2C12 cells.
Immunofluorescence Analysis: A 1:100 dilution from a representative lot detected Laminin 2 in human heart tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Laminin a2 (UniProt: P24043; also known as Laminin M chain, Laminin-12 subunit alpha, Laminin-2 subunit alpha, Laminin-4 subunit alpha, Merosin heavy chain) is encoded by the LAMA2 (also known as LAMM) gene (Gene ID: 3908) in human. Laminins are a family of heterotrimeric extracellular glycoproteins consisting of alpha, beta, and gamma chains that are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Laminins mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Thus far five alpha, three beta, and three gamma subunits are known, which assemble into at least 15 different laminin molecules. Laminin a2 is a glycoprotein with multiple EGF-like domains and is synthesized with a signal peptide (aa 1-22), which is subsequently cleaved off. It is expressed in multiple tissues, including placenta, striated muscle, cardiac muscle, pancreas, lung, spleen, skin, bone, and some regions of the brain. Laminin a2 binds to cells via a high affinity receptor and mediates the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Mutations in LAMA2 gene have been linked Merosin-deficient congenital muscular dystrophy 1A (MDC1A) and limb-girdle muscular dystrophy that results in muscle weakness and atrophy. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 2I22, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 343.91 kDa, observed mol wt ~350 kDa species reactivity mouse, human packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Laminin antibody produced in rabbit
MDL number: MFCD00162586 NACRES: NA.41
Кат. номер L9393-.2ML L9393-100UL L9393-.5ML General descriptionLaminin is a ubiquitous non-collagenous connective tissue glycoprotein that is a major constituent of basement membranes. Laminins are extracellular matrix proteins. The LAMA1 (laminin subunit α 1) gene is mapped to human chromosome 18p11. The antibody is isolated from antiserum by immunospecific methods of purification. Antigen specific isolation removes essentially all rabbit serum proteins, including immunoglobulins that do not specifically bind to laminin.
Specificity
Specificity of the anti-laminin antibodies is determined by indirect immunofluorescent labeling of formalin-fixed, paraffin-embedded human or animal tissue sections, and by dot blot immunoassay. By indirect immunofluorescence the antibody demonstrates specific basement membrane staining of enzymatically unmasked human and animal tissue. In the dot blot immunoassay the rabbit anti-laminin antibody reacts with laminin but not with fibronectin, vitronectin, collagen IV, or chondroitin sulfate types A, B, and C. The affinity isolated antibody to laminin will react with laminin of human, mammal, avian, reptilian, and amphibian sources.ImmunogenLaminin isolated from the basement membrane of Englebreth Holm-Swarm (EHS) mouse sarcoma.ApplicationAnti-Laminin antibody has been used in immunohistochemical staining and immunohistochemistry.
Rabbit Anti-Laminin antibody may be used in immunohistochemistry for marking blood vessel walls in different species, classification of various disease processes involving basement membranes, identification of the origin of human tumors and their classification, and for distinguishing between non-invasive and invasive lesions. The antibody may be used to monitor levels of laminin in biological fluids and for experimental production of basement membrane lesions in vivo.
A working dilution of at least 1:1,000 was determined by a dot blot immunoassay using laminin at 50 ng per dot.
A working dilution of at least 1:25 was determined by indirect immunohistology using formalin-fixed, paraffin-embedded human and animal tissues.
Biochem/physiol Actions
LAMA1 (laminin subunit α 1) is involved in several diseases like cancer, infections, inflammatory diseases and autoimmune disorders. Mutations in LAMA1 result in cerebellar dysplasia and cysts with and without retinal dystrophy. LAMA1 is also essential in the assembly of basement membrane and early growth of embryo.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% BSA and 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8 °C for up to one month. For extended storage, the solution may be frozen in working aliquots. Repeated freezing and thawing, or storage in "frost-free" freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify by centrifugation before use.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 300 biological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution species reactivity human, animal enhanced validation independent concentration 0.5 mg/mL application(s) dot blot: 1:1,000","immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:30 using human and animal tissues","microarray: suitable conjugate unconjugated Featured Industry Research Pathology UniProt accession no. P25391, shipped in dry ice storage temp. 20°C Gene Information human ... LAMA1(284217)
mouse ... Lama1(16772)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Laminin antibody, Mouse monoclonal SAB4200719-100UL
NACRES: NA.41 General descriptionMonoclonal anti-laminin antibody (mouse IgG1 isotype) is derived from the LAM-89 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from a mouse immunized with purified laminin from human placenta. Monoclonal anti-laminin antibody specifically recognizes laminin from human, feline and porcine origin. The antibody shows reactivity with laminin and specifically staining basal membrane of blood vessels, epithelium, nerve and muscle fiber. Monoclonal anti-laminin shows no reaction with collagen IV, fibronectin, vitronectin and chondroitin sulfate type A, B or C. Laminins are complexed extracellular glycoproteins which assemble the basal components of the basement membrane (BM). Each laminin is a heterotrimer (~850kDa) comprising of an α (~400kDa), β (~200kDa) and γ (~200kDa) chains all held together by disulfide bonds.
Specificity
Monoclonal Anti-Laminin antibody specifically recognizes Laminin from human, feline and porcine origin.Immunogenpurified Laminin from human PlacentaApplicationMonoclonal Anti-Laminin is recommended to use in various immunochemical assays, including immunohistochemistry, immunoblotting (~850 kDa), immunofluorescence, Enzyme linked immunosorbent assay (ELISA) and electron microscopy.
Biochem/physiol Actions
Laminins contribute to the structure of the extracellular matrix (ECM). It also plays a major role in the regulation of variety of cellular processes, such as the rates of cell proliferation, differentiation, adhesion, migration, cell shaping, phenotype stability and resistance to apoptosis. Laminin polymers forms supramolecular network with collagen IV polymers through heparan sulfate proteoglycan and by nidogen (entactin) and plays an important role in the basement membrane (BM) stability. In mouse, mutations in the gene is associated with the development of muscular dystrophy.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20°C. For continuous use, store at 2–8°C for up to one month. For extended storage, freeze in working aliquots. Repeated freezing and thawing is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilution samples should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse antibody form purified from hybridoma cell culture antibody product type primary antibodies clone LAM-89, monoclonal form buffered aqueous solution mol wt ~850 kDa species reactivity feline, porcine, human enhanced validation independent concentration ~1.0 mg/mL application(s) ELISA: suitable","electron microscopy: suitable","immunoblotting: 0.03-0.06 µg/mL using Laminin from Engelbreth-Holm-Swarm murine sarcoma basement membrane","immunofluorescence: suitable","immunohistochemistry: 20-40 µg/mL using pronase-retrieved formalin-fixed, paraffin-embedded human tongue sections. isotype IgG1 UniProt accession no. P25391, shipped in dry ice storage temp. 20°C
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Laminin B2 Antibody, clone 1B9 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1271-25UL ZRB1271-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1B9 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Laminin B2. It targets an epitope within the C-terminal half.ImmunogenHis-tagged recombinant fragment corresponding to 295 amino acids from the C-terminal half of human Laminin B2.ApplicationQuality Control Testing
Evaluated by Western Blotting in A431 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Laminin B2 in A431 cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected Laminin B2 in Human heart tissue and HepG2 cell lysates.
Flow Cytometry Analysis: 1 µg from a representative lot detected Laminin B2 in one million HepG2 cells.
Affinity Binding Assay: A representative lot of this antibody bound Laminin B2 proteins with a KD of 2.0 x 10-7 in an affinity binding assay.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected Laminin B2 in human heart tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Laminin B2, clone 1B9 ZooMAb®, Cat. No. ZRB1271, is a recombinant Rabbit monoclonal antibody that specifically targets Laminin B2 and is tested for use in Affinity Binding Assay, Flow Cytometry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Laminin subunit beta-2 (UniProt: P55268; also known as Laminin B1s chain, Laminin-11 subunit beta, Laminin-14 subunit beta, Laminin-15 subunit beta, Laminin-3 subunit beta, Laminin-4 subunit beta, Laminin-7 subunit beta, Laminin-9 subunit beta, S-laminin subunit beta, S-LAM beta) is encoded by the LAMB2 (also known as LAMS) gene (Gene ID: 3913) in human. Laminins are the major non-collagenous constituent of basement membranes that participate in wide variety of biological processes, including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. They are a family of heterotrimeric extracellular glycoproteins consisting of alpha, beta, and gamma chains that are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Laminins mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Thus far five alpha, three beta, and three gamma subunits are known, which assemble into at least 15 different laminin molecules. Laminin beta 2 is a subunit of laminin-3 (laminin-121 or S-laminin), laminin-4 (laminin-221 or S-merosin), laminin-7 (laminin-321 or KS-laminin), laminin-9 (laminin-421), laminin-11 (laminin-521), laminin-14 (laminin-423) and laminin-15 (laminin-523). It is synthesized with a signal peptide ( 1-32) that is subsequently cleaved off to generate the mature form. It contains 13 different EGF-like domains. It is shown to be concentrated in the synaptic cleft of the neuromuscular junctions, and is present in kidney glomerulus, and vascular smooth muscle. Transgenic mice with inactive beta 2 laminin display defects in the maturation of neuromuscular junctions and impaired glomerular filtration. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1B9, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt ~ 195.98 kDa, observed mol wt ~ 196 kDa species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, flow cytometry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Laminin-5 2 Antibody, clone D4B5 ZooMAb® Mouse Monoclonal
Кат. номер ZMS1059-25UL ZMS1059-4X25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone D4B5 is a ZooMAb® Mouse recombinant monoclonal antibody that specifically detects Laminin-5 g2. It targets an epitope within the internal region and detects both isoforms.ImmunogenGST-tagged recombinant fragment corresponding to 227 amino acids from the internal region of human.ApplicationQuality Control Testing
Evaluated by Western Blotting with recombinant Laminin 5 g2.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected human recombinant Laminin 5 g2.
Tested applications
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Laminin-5 gamma2 in A431 Cell line.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected Laminin-5 gamma2 in human skin tissue sections.
ELISA Analysis: 300 µg/mL from a representative lot detected Laminin-5 gamma2 in Laminin-5 with control GST.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Laminin-5 g2, clone D4B5 ZooMAb®, Cat. No. ZMS1059, is a recombinant Mouse monoclonal antibody that detects Laminin-5 (g2 chain) and is tested for use in ELISA, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Laminin subunit gamma-2 (UniProt: Q13753; also known as Cell-scattering factor 140 kDa subunit, CSF 140 kDa subunit, Epiligrin subunit gamma, Kalinin subunit gamma, Kalinin/nicein/epiligrin 100 kDa subunit, Ladsin 140 kDa subunit, Laminin B2t chain, Laminin-5 subunit gamma, Large adhesive scatter factor 140 kDa subunit, Nicein subunit gamma) is encoded by the LAMC2 (also known as LAMB2T, LAMNB2) gene (Gene ID: 3918) in human. Laminin is a major basement membrane glycoprotein consisting of a, b, g chains that are bound to each other by disulfide bonds. Over 15 different isoforms have been reported in the laminin family that are expressed in a tissue-specific manner and play different role in each tissue. g2, a subunit of Laminin-5 (also known as Laminin-332) is synthesized with a signal peptide (aa 1-21), which is subsequently cleaved off to generate the mature form. It is reported to be frequently over-expressed as a monomer or as the b3- g2 heterodimer in invasive cancers and is regarded as an invasion marker. It has 8 EGF-like domains. The cell adhesion and motility activities of Laminin-5 are reported to be regulated by the proteolytic cleavage of the short arm of Laminin g2 chain by BMP-1 or MT1-MMP. This cleavage releases a 45 kDa N-terminal proteolytic fragment (g2pf). The short arm and g2 pf can be further cleaved by serine proteases and by matrix metalloproteinases resulting in the release of small N-terminal fragments. g2pflike fragments have been reported to be present in conditioned media of cultured cancer cells and in sera from human cancer subjects. Laminin 5 synthesis in shown to be enhanced by inflammatory cytokines and growth factors that help in wound repair. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Miyazaki, K., et al. (2016). Cancer Sci. 107(12); 1909-1918; Sato, H., et al. (2014). Cancer Sci. 105(2); 168-175; Amano S., et al. (2004). Br. J. Dermatol. 151(5); 961-970).
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры
