Каталог
Товары в наличии
- загружается список...
Производители
- загружается список...
Измерительные приборы
- загружается список...
Перемешивание и встряхивание
- загружается список...
Отбор проб и пробоподготовка
- загружается список...
Перегонка, разделение и фильтрование
- загружается список...
Нагревание и охлаждение
- загружается список...
Дозирование жидкостей
- загружается список...
Вакуумная техника
- загружается список...
Микроскопы и оптика
- загружается список...
Оборудование для очистки воды
- загружается список...
Оборудование для очистки, дезинфекции и стерилизации
- загружается список...
Анализ продуктов питания, воды и почв
- загружается список...
Микробиология и биотехнология
- загружается список...
Хроматография: приборы и принадлежности
- загружается список...
Расходные материалы для лабораторий
- загружается список...
Охрана труда и безопасность в лаборатории
- загружается список...
Оборудование для фармацевтических и пищевых производств
- загружается список...
Пилотное производство
- загружается список...
Лабораторная посуда
- загружается список...
Мебель лабораторная
- загружается список...
Тестеры контроля качества фармацевтических препаратов
- загружается список...
Sigma-Aldrich
Новинки
- загружается список...
Antibodies
- Сортировать:
- Вид таблицей
-
Anti-CD133 (Prominin-1) Antibody, clone 2F8, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1013-25UL ZRB1013-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.SpecificityClone 2F8 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects CD133 (Prominin-1). It targets an epitope with in 77 amino acids fromt the N-terminal extracellualr domain.ImmunogenHis-tagged recombinant fragment corresponding to 77 amino acids from the N-terminal region of human CD133 (Prominin-1).ApplicationImmunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD133 (Prominin-1) in rat kidney tissue sections.
Immunofluorescence Analysis: A 1:100 dilution from a representative lot detected CD133 (Prominin-1) in rat kidney tissue sections.
Anti-CD133 (Prominin-1), clone 2F8 ZooMAb, Cat. No. ZRB1013, is a recombinant Rabbit Monoclonal Antibody that specifically targets Prominin (CD133) and has been tested for use in Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Prominin-1 (UniProt: O43490; also known as Antigen AC133, Prominin-like protein 1, CD133) is encoded by the PROM1 (also known as PROML1, MSTP061) gene (Gene ID: 8842) in human. CD133 (Prominin-1) is multi-pass cell-surface glycoprotein that plays a role in cell differentiation, proliferation and apoptosis. It binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development CD133 acts as a key regulator of disk morphogenesis. Defects in PROM1 gene are known to cause retinitis pigmentosa, cone-rod dystrophy, and retinal macular dystrophy 2. Higher levels of CD133 have been reported in several cancer cell types, including various leukemias, retinoblastomas, glioblastomas, and kidney carcinomas. Higher levels of CD133 are also observed in pancreatic, gastric, colorectal, and hepatocellular cancers. It is also considered as a marker of stem cells in the adult small intestine that are susceptible to transformation into tumors retaining a fraction of mutant Prom1+ tumor cells. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Zhu, L., et al. (2009). Nature 477 (7229); 603-607).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 2F8, monoclonal","recombinant monoclonal product line ZooMAb® form lyophilized mol wt calculated mol wt 97.11 kDa","observed mol wt ~100 kDa species reactivity rat, human packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency.enhanced validation recombinant expression application(s) immunofluorescence: suitable using 1:100","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable using 1:100","western blot: suitable isotype IgG conjugate unconjugated UniProt accession no. O43490, shipped in ambient storage temp. 2-8°C Gene Information human ... PROM1;PROML1;MSTP061(8842)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CD14 antibody produced in rabbit
MDL number: MFCD00164622 Human Protein Atlas Number: HPA001887 Human Protein Atlas characterization data
Кат. номер HPA001887-100UL HPA001887-25UL General descriptionMonocyte differentiation antigen CD14 is located at 5q31.1 on the human chromosome.
CD14 is a phospholipid anchored membrane protein with 55kDa molecular mass. It contains a bent solenoid, high leucine content (15.5%) region, and an extended amino-terminal pocket for binding acylated ligands. It is highly present in mature monocyte, macrophages and neutrophils and to lesser extent on granulocytes.ImmunogenMonocyte differentiation antigen CD14 precursor recombinant protein epitope signature tag (PrEST)ApplicationAnti-CD14 antibody produced in rabbit has been used in:- immunofluorescence
- immunohistochemistry
- western blotting
Anti-CD14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
CD14 is a pattern recognition receptor which helps to enhance the immune response during infection. During infection, CD14 first sensitize the cell to lipopolysaccharide and other lipoproteins followed by delivering these lipidated products to various Toll-like receptor signaling complexes. After delivery, it induces proinflammatory signaling cascades by ligand binding and causes cellular immune responses.
Monocyte differentiation antigen CD14 is weakly associated with Crohn′s disease (CD) and ulcerative colitis (UC).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST84388,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
recombinant expression
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL conjugate unconjugated Featured Industry Research Pathology UniProt accession no. P08571, shipped in wet ice storage temp. 20°C Gene Information human ... CD14(929)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-CD14 Antibody, clone 1B4 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1294-25UL ZRB1294-4X25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.SpecificityClone 1B4 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Monocyte differentiation antigen CD14. It targets an epitope within 16 amino acids from the C-terminal region.ImmunogenKLH conjugated linear peptide corresponding to 16 amino acids from the C-terminal region of human Monocyte differentiation antigen CD14.ApplicationQuality Control Testing
Evaluated by Western Blotting in THP-1 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected CD14 in THP-1 cell lysate.
Tested applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected CD14 in human liver tissue lysate.
Flow Cytometry Analysis: 0.1 µg from a representative lot detected CD14 in one million THP-1 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected CD14 in human tonsil tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected CD14 in THP-1 cells.
Affinity Binding Assay: A representative lot of this antibody bound CD14 peptide with a KD of 1.0 x 10-12 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-CD14, clone 1B4 ZooMAb®, Cat. No. ZRB1294, is a recombinant Rabbit monoclonal antibody that specifically targets CD14 and is tested for use in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Target description
Monocyte differentiation antigen CD14 (UniProt: P08571; also known as Myeloid cell-specific leucine-rich glycoprotein, CD14) is encoded by the CD14 gene (Gene ID: 929) in human. CD14 is a GPI-anchor membrane glycoprotein that serves as a co-receptor for several Toll-like receptors. Together with TLR4 and MD-2, it forms the multi-receptor complex that recognizes Lipopolysaccharide (LPS) on the cell membrane. In the presence of LPS, CD14 and TLR4-MD2 are brought into close proximity inside lipid rafts and after translocation into the lipid rafts, TLR4 in the plasma membrane activates the TIRAP-MyD88-dependent pathway that leads to the first wave of NF-B activation. CD14 also acts as a co-receptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides. These clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. CD14 expression has been reported on cells of both hematopoietic and non-hematopoietic origin. A secreted form of CD14 has also reported that arises from the cleavage of the GPI anchor. CD14 is expressed on macrophages and a strong expression has been reported on the surface of monocytes. Its expression on monocytes is induced by 27-hydroxycholesterol that primes monocytes/macrophages to accelerate LPS-mediated inflammatory reaction. CD14-deficient macrophages display a significantly reduced sensitivity to low concentrations of LPS compared to wild-type cells and CD14 deficient mice do not develop septic shock after exposure to LPS or Gram-negative bacteria. CD14 is synthesized with a signal peptide (aa 1-19) and a propeptide (aa 346-375) that are cleaved off to generate the mature form. The mature form contains 11 leucine-rich repeats (LRR) that are required for responses to smooth LPS. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Zanoni, I., and Granucci, F. (2013). Front. Cell. Infect. Microbiol. 3; 32).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры