Anti-GCNT2 antibody produced in rabbit

Human Protein Atlas Number:

HPA026776    Human Protein Atlas characterization data

Кат. номер

HPA026776-100UL

HPA026776-25UL

Glucosaminyl (N-acetyl) transferase 2 (GCNT2) protein is encoded by the novel metastasis-related gene mapped to human chromosome 6p24. The GCNT2 protein belongs to the β-1, 6-N-acetylglucosaminyltransferase family, which has an essential role in glycosylation.
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase recombinant protein epitope signature tag (PrEST)
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Biochem/physiol Actions
Glucosaminyl (N-acetyl) transferase 2 (GCNT2) is an enzyme essential for the development of the blood group I antigen. Biallelic mutation of GCNT2 leads to autosomal recessive congenital cataracts and the rare adult i blood group. GCNT2 associates with 1,3-N-acetylglucosminyltransferase 2(3GnT2) to regulate the PLN levels in olfactory neurons by modulating 1, 6-branches that aids in Poly-N-acetyllactosamine (PLN) extension. Over human developmental stage, GCNT2 enzyme transforms linear i-antigen to I-branching glycan by replacing GlcNAc of uridine diphosphate–GlcNAc with galactose 1-6 linkage of linear lactosamine chains. Uprooted expression of GCNT2 enzyme increases cell detachment, cell adhesion, cell migration and invasion in vitro, and lung metastasis of breast cancer cells in vivo. Overexpression of GCNT2 contributes to breast cancer metastasis. Transforming growth factor-1 (TGF-1) acts as an effector of GCNT2 enzyme and plays a major role in TGF-1induced epithelial-to-mesenchymal transition (EMT).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71799,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	EVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDT
conjugate	unconjugated
UniProt accession no.	Q8N0V5,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... GCNT2(2651)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable