Anti-GUCA2A antibody produced in rabbit

Human Protein Atlas Number:

HPA018215    Human Protein Atlas characterization data

Кат. номер

HPA018215-100UL

HPA018215-25UL

The gene guanylate cyclase activator 2A (GUCA2A) is mapped to human chromosome 1p35-p34. GUCA2A mRNA is mainly detected in the gastrointestinal tract and kidney.
Guanylin precursor recombinant protein epitope signature tag (PrEST)
Biochem/physiol Actions
Guanylate cyclase activator 2A (GUCA2A) is mainly an intestinal peptide hormone and endogenous ligand of guanylyl cyclase C. It is produced as prohormone proguanylin. In the intestine, GUCA2A along with guanylate cyclase C receptor activates epithelial cells. Activation of this pathway results in secretion of Cl- and HCO3- and inhibition of Na+ absorption, which drives water secretion into the intestinal lumen. In the renal tissue GUCA2A elicits natriuresis, kaliuresis, and diuresis, along with increasing urinary cyclic guanosine monophosphate (cGMP) levels. GUCA2A is suggested to elevate the exrection of urinary salt and water, which results in the prevention of hypernatremia and hypervolemia following increased salt uptake by the body. The protein is also expressed in epithelial cells of the ductal system of human parotid and submandibular glands. It is released into the saliva through salivary duct cells. GUCA2A is highly expressed in salivary gland tumors. On the other hand, GUCA2A is down-regulated in colorectal cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72418,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq recombinant expression
application(s)	immunohistochemistry: 1:1000-1:2500","western blot: 0.04-0.4 µg/mL
immunogen sequence	SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
conjugate	unconjugated
UniProt accession no.	Q02747,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... GUCA2A(2980)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable