Узнать цену

Производитель может поднять цены — запросите коммерческое предложение сейчас, и мы зафиксируем за вами текущую цену.

  • img
    Привезем под заказ
  • img
    Срок поставки с завода 6-8 недель

Anti-LRRC47 antibody produced in rabbit HPA008512-100UL

Гарантия 1 год
Код:
HPA008512-100UL
Производитель:
Sigma-Aldrich
Онлайн консультант Анна Головацкая
Онлайн консультант Анна Головацкая Получить консультацию эксперта
Производитель:
Sigma-Aldrich
Human Protein Atlas Number:HPA008512    Human Protein Atlas characterization data

Immunogen
Leucine-rich repeat-containing protein 47 recombinant protein epitope signature tag (PrEST)
Sequence
PGNALKRFLTSQTKLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEK
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Deletions in the gene encoding Leucine-rich repeat-containing protein 47 (LRRC47) has found to be correlated to malignant brain cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage
Corresponding Antigen APREST70330,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Параметры
biological sourcerabbit
Quality Level100
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
clonepolyclonal
product linePrestige Antibodies® Powered by Atlas Antibodies
formbuffered aqueous glycerol solution
species reactivityhuman, rat, mouse
enhanced validationindependent
application(s)immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
conjugateunconjugated
UniProt accession no.Q8N1G4,
shipped inwet ice
storage temp.20°C
Gene Informationhuman ... LRRC47(57470)

Safety Information
Personal Protective EquipmentEyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADRNONH for all modes of transport
WGK GermanyWGK 1
Flash Point FNot applicable
Flash Point CNot applicable
Пуско-наладка
Выполним распаковку, визуальную проверку, сборку и установку, запуск и настройку, проверку функциональности, проведем инструктаж персонала.
Техническое обслуживание
Проведем периодические регламентные работы: визуальный осмотр, очистка засоренных узлов и частей, замена расходных материалов и изношенных деталей, тестирование прибора, проверка показателей и измерение параметров, калибровка и настройка, обновление программного обеспечения.
IQ/OQ/PQ квалификация, валидация
Проведем монтажную (IQ), операционную (OQ) и эксплуатационную (PQ) квалификацию оборудования по протоколам производителя в полном соответствии с стандартами GMP/GLP.
Ремонт
Проведем диагностику в нашем сервисном центре или у Вас на предприятии, выявим причину поломки, устраним неисправность, проведем тестирование, настройку, калибровку отремонтированного оборудования.

Получите коммерческое предложение в течение 1 часа

Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа

img
Анна Гловацкая Менеджер по работе с клиентами
Получите коммерческое предложение в течение 1 часа
Как к вам обращаться?
Введите телефон
Введите email
Комментарий (если есть)
Прикрепить ТЗ или заявку (до 10 мб)

С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии

img
Обрудование подберут сотрудники с высшим химическим образованием

Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.

img
Организуем поставку с завода- изготовителя за 6-8 недель

У большинства компаний срок ожидания составляет 10-12 недель.

img
Храним оборудование по требованиям производителя

Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.

img
Доставим по Москве на следующий день, по России — за 3-4 дня

Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.

img
Выполним бесплатный ремонт и сервисное обслуживание

В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.

img
Обеспечим легкое внедрение на предприятие

Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.

Отзывы

Узнать цену

Производитель может поднять цены — запросите коммерческое предложение сейчас, и мы зафиксируем за вами текущую цену.

  • img
    Привезем под заказ
  • img
    Срок поставки с завода 6-8 недель

Anti-LRRC47 antibody produced in rabbit HPA008512-100UL

Гарантия 1 год
Код:
HPA008512-100UL
Производитель:
Sigma-Aldrich
Онлайн консультант Анна Головацкая
Онлайн консультант Анна Головацкая Получить консультацию эксперта

Похожие товары: