- Главная
- Sigma-Aldrich
- Protein Biology
- Antibodies
- Enhanced Validation Antibodies
Каталог
Товары в наличии
- загружается список...
Производители
- загружается список...
Измерительные приборы
- загружается список...
Перемешивание и встряхивание
- загружается список...
Отбор проб и пробоподготовка
- загружается список...
Перегонка, разделение и фильтрование
- загружается список...
Нагревание и охлаждение
- загружается список...
Дозирование жидкостей
- загружается список...
Вакуумная техника
- загружается список...
Микроскопы и оптика
- загружается список...
Оборудование для очистки воды
- загружается список...
Оборудование для очистки, дезинфекции и стерилизации
- загружается список...
Анализ продуктов питания, воды и почв
- загружается список...
Микробиология и биотехнология
- загружается список...
Хроматография: приборы и принадлежности
- загружается список...
Расходные материалы для лабораторий
- загружается список...
Охрана труда и безопасность в лаборатории
- загружается список...
Оборудование для фармацевтических и пищевых производств
- загружается список...
Пилотное производство
- загружается список...
Лабораторная посуда
- загружается список...
Мебель лабораторная
- загружается список...
Тестеры контроля качества фармацевтических препаратов
- загружается список...
Sigma-Aldrich
Новинки
- загружается список...
Enhanced Validation Antibodies
- Сортировать:
- Вид таблицей
-
Anti-CORO2B antibody produced in rabbit
Human Protein Atlas Number: HPA017960 Human Protein Atlas characterization data
Кат. номер HPA017960-100UL HPA017960-25UL General descriptionCoronin actin binding protein, 2B (CORO2B) belongs to the coronin-like protein (Clipin) family and is a type II coronin isoform. It is expressed in the brain, and possesses a WD domain and an α-helical region. The gene encoding CORO2B is located on human chromosome 15.ImmunogenCoronin-2B recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Coronin actin binding protein, 2B (CORO2B) is a component of the cross-bridge between the plasma membrane and actin cytoskeleton. CORO2B may also function in the rearrangement of neuronal actin.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72566,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence YQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVVVNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQ conjugate unconjugated UniProt accession no. Q9UQ03, shipped in wet ice storage temp. 20°C Gene Information human ... CORO2B(10391)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-Cortactin Antibody, clone 1F15 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1329-25UL ZRB1329-4X25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1F15 is a Rabbit recombinant monoclonal antibody that specifically detects Cortactin. It targets an epitope within 20 amino acids from the C-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 20 amino acids from the C-terminal half of human Cortactin.ApplicationQuality Control Testing
Evaluated by Western Blotting in K562 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Cortactin in K562 cell lysate.
Tested applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected Cortactin in HeLa, NIH3T3, and L6 cell lysates.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Cortactin in A431, HeLa, HepG2 and NIH 3T3 cells.
Affinity Binding Assay: A representative lot of this antibody bound Cortactin with a KD of 2.7 x 10-7 in an affinity binding assay.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected Cortactin in human stomach tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Cortactin, clone 1F15 ZooMAb®, Cat. No. ZRB1329, is a recombinant Rabbit monoclonal antibody that targets Cortactin and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Src substrate cortactin (UniProt: Q14247; also known as Amplaxin, Oncogene EMS1) is encoded by the CTTN (also known as EMS) gene (Gene ID: 2017) in human. Cortactin is a peripheral membrane protein that serves as a substrate for Src tyrosine kinase and plays a role in regulating cell motility. It is shown to interact with F-actin to promote its polymerization and branching and contributes to the organization of the actin cytoskeleton and cell shape. It also plays a role in the formation of lamellipodia and in cell migration. Cortactin contains an N-terminal acidic domain, six and a half tandem repeats of a unique 37-amino acid sequence, and a C-terminal Src homology (SH3) domain (aa 492-550). The repeat regions are shown to be essential for F-actin binding. Cortactin is activated via phosphorylation by upstream kinases in response to extracellular stimuli. In mice, Src kinase primarily phosphorylates cortactin at tyrosines 421, 466, and 482, which leads its interaction with F-actin and Arp2/3. It can also be phosphorylated by ERK on serine 405 and 418 that results in recruitment of additional actin nucleation-promoting factors (NPFs), most importantly N-WASP, to the Arp2/3/ complex. Cortactin can undergo acetylation by p300 and PCAF acetyltransferase and its acetylation sites are shown to cluster in the repeat region of cortactin harboring its F-actin binding site. Acetylated cortactin loses the positive charge at respective lysines that results in the loss of its F-actin binding. Overexpression of cortactin has been reported in many human tumors and its expression correlates well with the metastatic potential of breast cancer cells and hepatocellular carcinomas. Its level is associated with increased cell migration, metastasis, and poor prognosis. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Gattazzo, C. (2014). Haematologica. 99(6); 1069-1077).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
30 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rabbit recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1F15, recombinant monoclonal description recombinant, expressed in HEK 293 cells product line ZooMAb® form lyophilized mol wt calculated mol wt 61.59 kDa","observed mol wt ~70 kDa purified by using Protein A species reactivity mouse, human, rat packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) affinity binding assay: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG epitope sequence C-terminal half conjugate unconjugated Protein ID accession no. NP_005222, UniProt accession no. Q14247, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 2 Flash Point F Not applicable Flash Point C Not applicable -
HPA008918-100UL
Anti-COTL1 antibody produced in rabbit HPA008918-100UL
Human Protein Atlas Number: HPA008918 Human Protein Atlas characterization data Immunogencoactosin-like F-actin binding protein 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70209,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence IWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL conjugate unconjugated UniProt accession no. Q14019, shipped in wet ice storage temp. 20°C Gene Information human ... COTL1(23406)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-COX IV Antibody, clone 1L23 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1593-25UL ZRB1593-4X25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1L23 is a ZooMAb® Rabbit recombinant monoclonal antibody that specifically detects Cytochrome c oxidase subunit 4 isoform 1 (COX-IV). It targets an epitope within 20 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 20 amino acids from the N-terminal region of human Cytochrome c oxidase subunit 4 (COX IV).ApplicationQuality Control Testing
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected COX IV in HeLa cell lysate.
Tested applications
Western Blotting Analysis: A 1:10,000 dilution from a representative lot detected COX IV in HepG2 and MCF-7 cell lysate.
Flow Cytometry Analysis: 1 µg from a representative detected COX IV in one million HepG2 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative detected COX IV in human heart tissue sections.
Immunocytochemistry Analysis: A 1:100 Dilution from a representative detected COX IV in HeLa cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-COX IV, clone 1L23 ZooMAb®, Cat. No. ZRB1593, is a recombinant Rabbit monoclonal antibody that specifically targets COX IV and is tested for use in Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (UniProt: P13073; also known as Cytochrome c oxidase polypeptide IV, Cytochrome c oxidase subunit IV isoform 1, COX IV-1) is encoded by the COX4I1 (also known as COX4) gene (Gene ID: 1327) in human. COX IV is a single-pass membrane protein that is synthesized with a mitochondria transit peptide (aa 1-24), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 25-98), a transmembrane domain (99-124), and a cytoplasmic domain (aa 125-169). It is a component of the cytochrome c oxidase (complex IV), a multi-subunit enzyme composed of 14 subunits. Cytochrome c oxidase catalyzes the final step in mitochondrial electron transfer chain and is regarded as one of the major regulation sites for oxidative phosphorylation. It catalyzes the reduction of oxygen to water. The complex is composed of a catalytic core of 3 subunits MT-CO1, MT-CO2, and MT-CO3 and 11 supernumerary subunits COX4I1, COX5A, COX5B, COX6A1/2, COX6B1/2, COX6C, COX7A1/2, COX7B, COX7C, COX8A, and NDUFA4. The catalytic core subunits are encoded by mitochondrial DNA and the supernumerary subunits are encoded by the nuclear genome. Mutations in COX4 are known to cause nuclear type 16 mitochondrial complex IV deficiency, an autosomal recessive disorder that results in poor growth, microcephaly, hypotonia, and cerebral and cerebellar atrophy. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Li, Y., et al. (2006). J. Bioenerg. Biomembr. 38(5-6); 283-291).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rabbit recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1L23, recombinant monoclonal description recombinant, expressed in HEK 293 cells product line ZooMAb® form lyophilized mol wt calculated mol wt 19.58 kDa","observed mol wt ~17 kDa purified by using Protein A species reactivity human species reactivity (predicted by homology) chimpanzee packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) flow cytometry: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG epitope sequence N-terminal conjugate unconjugated Protein ID accession no. NP_001305715, UniProt accession no. P13073, shipped in ambient storage temp. 2-8°C -
Anti-COX10 antibody produced in rabbit
Human Protein Atlas Number: HPA032006 Human Protein Atlas characterization data
Кат. номер HPA032006-100UL HPA032006-25UL ImmunogenCOX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase (yeast) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78405,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence CVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRP conjugate unconjugated UniProt accession no. Q12887, shipped in wet ice storage temp. 20°C Gene Information human ... COX10(1352)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-COX19 antibody produced in rabbit
Human Protein Atlas Number: HPA021226 Human Protein Atlas characterization data
Кат. номер HPA021226-100UL HPA021226-25UL General descriptionThe gene COX19 (cytochrome c oxidase assembly protein) is mapped to human chromosome 7p22.3. The protein localizes in the cytoplasm and mitochondria.ImmunogenCytochrome c oxidase assembly protein COX19 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
COX19 (cytochrome c oxidase assembly protein) is important for cytochrome c oxidase (COX) assembly by regulating delivery and insertion of copper into COX I and COX II. ATP7A (copper-transporting ATPase 1)-mediated copper efflux from the cell is controlled by SCO1 (COX assemble protein)-dependent mitochondrial redox signal. COX19 is important for the transduction of SCO1-associated mitochondrial redox response.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75123,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
orthogonal RNAseqapplication(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence NFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGD conjugate unconjugated UniProt accession no. Q49B96, shipped in wet ice storage temp. 20°C Gene Information human ... COX19(90639)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
SAB4200576-200UL
Anti-COX2 antibody produced in rabbit SAB4200576-200UL
NACRES: NA.41 General descriptionCytochrome c oxidase subunit II (COX2) is encoded by the gene mapped to human chromosome 1. The encoded protein is one of the isoforms of COX protein. It is expressed in specific cells such as activated macrophages, monocytes, neutrophils and lymphocytes, in response to inflammatory stimuli such as mitogen, cytokines and growth factors.Immunogensynthetic peptide corresponding to an internal sequence of human COX2 (GeneID: 5743), conjugated to KLH. The corresponding sequence has high homology to rat COX2 (83% identity) and to mouse COX2 (82% identity).ApplicationAnti-COX2 antibody produced in rabbit has been used in immunohistochemical staining.
Biochem/physiol Actions
Cyclooxygenase (COX) catalyzes the conversion of arachidonic acid (AA) to prostaglandins (PG). Mutation in the gene is associated with the development of gastric cancer. Elevated expression of the gene has been observed in various chronic and autoimmune diseases.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~75 kDa species reactivity human, mouse enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,concentration ~1.0 mg/mL application(s) indirect immunofluorescence: 5-10 µg/mL using RAW-264.7 cells stimulated with LPS, western blot: 1.5-3.0 µg/mL using lysates of RAW-264.7 cells stimulated with LPS, and of HEK-293T cells overexpressing human COX2 conjugate unconjugated shipped in dry ice storage temp. 20°C Gene Information human ... COX2(5743)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable -
Anti-COX2 Antibody, clone 2B19 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1514-25UL ZRB1514-4X25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 2B19 is a Rabbit recombinant monoclonal antibody that specifically detects COX-2. It targets an epitope within 22 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 22 amino acids from the C-terminal region of human Cyclooxygenase-2 (COX-2).ApplicationQuality Control Testing
Evaluated by Western Blotting in A549 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected COX2 in A549 cell lysate.
Tested applications
Affinity Binding Assay: A representative lot of this antibody bound COX2 with a KD of 1.3 x 10-8 in an affinity binding assay.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected COX2 in human kidney tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected COX2 in A549 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-COX2, clone 2B19 ZooMAb®, Cat. No. ZRB1514, is a recombinant Rabbit monoclonal antibody that specifically targets COX2 and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Prostaglandin G/H synthase 2 (UniProt: P35354; also known as EC:1.14.99.1, Cyclooxygenase-2, COX-2, PHS II, Prostaglandin H2 synthase 2, PGH synthase 2, PGHS-2, Prostaglandin-endoperoxide synthase 2) is encoded by the PTGS2 (also known as COX2) gene (Gene ID: 5743) in human. COX2 is a peripheral membrane protein that is synthesized with a signal peptide (aa 1-17), which is subsequently cleaved off to generate the mature form that is detected on the lumenal side of the endoplasmic reticulum and nuclear envelope. It is an inducible enzyme and is generally present at very low levels in most tissues and its expression increases with cytokines and growth factor treatment. It is present mainly at inflammatory sites where it produces prostaglandins, which mediate inflammation, pain, and fever. COX2 displays cyclooxygenase and peroxidase activity in the biosynthesis pathway of prostanoid. Its cyclooxygenase activity oxygenates arachidonate to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide PGH2, the precursor of all 2-series prostaglandins and thromboxanes. It also catalyzes successive cyclooxygenation and peroxidation of dihomo-g-linoleate and eicosapentaenoate to corresponding PGH1 and PGH3, the precursors of 1- and 3-series prostaglandins. It is also shown to metabolize 2-arachidonoyl glycerol yielding the glyceryl ester of PGH2, a process that can contribute to pain response. In vascular endothelial cells, it converts docosapentaenoate (DPA) to 13R-HDPA that activates macrophage phagocytosis during bacterial infection. COX2 activity can be inhibited by nonsteroidal anti-inflammatory drugs. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры