- Главная
- Sigma-Aldrich
- Protein Biology
- Antibodies
- Enhanced Validation Antibodies
Каталог
Товары в наличии
- загружается список...
Производители
- загружается список...
Измерительные приборы
- загружается список...
Перемешивание и встряхивание
- загружается список...
Отбор проб и пробоподготовка
- загружается список...
Перегонка, разделение и фильтрование
- загружается список...
Нагревание и охлаждение
- загружается список...
Дозирование жидкостей
- загружается список...
Вакуумная техника
- загружается список...
Микроскопы и оптика
- загружается список...
Оборудование для очистки воды
- загружается список...
Оборудование для очистки, дезинфекции и стерилизации
- загружается список...
Анализ продуктов питания, воды и почв
- загружается список...
Микробиология и биотехнология
- загружается список...
Хроматография: приборы и принадлежности
- загружается список...
Расходные материалы для лабораторий
- загружается список...
Охрана труда и безопасность в лаборатории
- загружается список...
Оборудование для фармацевтических и пищевых производств
- загружается список...
Пилотное производство
- загружается список...
Лабораторная посуда
- загружается список...
Мебель лабораторная
- загружается список...
Тестеры контроля качества фармацевтических препаратов
- загружается список...
Sigma-Aldrich
Новинки
- загружается список...
Enhanced Validation Antibodies
- Сортировать:
- Вид таблицей
-
Anti-MME antibody produced in rabbit
Human Protein Atlas Number: HPA052583 Human Protein Atlas characterization data
Кат. номер HPA052583-100UL HPA052583-25UL Immunogenmembrane metallo-endopeptidaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88588,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunohistochemistry: 1:2500- 1:5000 isotype IgG immunogen sequence VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK conjugate unconjugated UniProt accession no. P08473, shipped in wet ice storage temp. 20°C Gene Information human ... MME(4311)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 -
Anti-MMGT1 antibody produced in rabbit
Human Protein Atlas Number: HPA032037 Human Protein Atlas characterization data
Кат. номер HPA032037-100UL HPA032037-25UL Immunogenmembrane magnesium transporter 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78296,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence KDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKL conjugate unconjugated UniProt accession no. Q8N4V1, shipped in wet ice storage temp. 20°C Gene Information human ... MMGT1(93380)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-MMP-14 Antibody, clone 1J5 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1760-25UL ZRB1760-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1J5 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Matrix metalloproteinase-14 (MMP-14). It targets an epitope within 16 amino acids from the extracellular domain.ImmunogenKLH-conjugated linear peptide corresponding to 16 amino acids from the extracellular domain of human Matrix metalloproteinase-14 (MMP14).ApplicationAnti-MMP-14, clone 1J5 ZooMAb®, Cat. No. ZRB1760, is a recombinant Rabbit monoclonal antibody that specifically targets MMP-14 and is tested in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in L929 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected MMP-14 in L929 cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected MMP-14 in A431 cell lysate.
Affinity Binding Assay: A representative lot of this antibody bound MMP14 peptides with a KD of 1.8 x 10-6 in an affinity binding assay.
Flow Cytometry Analysis: 0.1 µg from a representative lot detected MMP-14 in one million HepG2 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected MMP-14 in human colon tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected MMP-14 in HepG2 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Matrix metalloproteinase-14 (UniProt: P50281; also known as EC:3.4.24.80, MMP-14, MMP-X1, Membrane-type matrix metalloproteinase 1, MT-MMP 1, MTMMP1, Membrane-type-1 matrix metalloproteinase, MT1-MMP, MT1MMP) is encoded by the MMP14 gene (Gene ID: 4323) in human. MMPs are a family zinc-dependent endoproteinases that degrade collagen and other structural proteins and are responsible for much of the turnover of matrix components. Each MMP contains a protease domain with a conserved HExGHxxGxxHS/T sequence, where three histidine residues form a complex with a catalytic Zn atom. A regulatory domain with a conserved PRCGxPD motif helps to maintain MMPs in their latent form by binding of the cysteine residue to the active site Zn. MMP-14 is a single-pass type I membrane protein that is expressed in stromal cells of colon, breast, head, and neck. It is a membrane type matrix metalloproteinase (MT-MMP) that is synthesized with a signal peptide (aa 1-20) and a propeptide (aa 21-111) that are subsequently cleaved off to generate the active mature form. The propeptide maintains it in a latent state. The mature enzyme contains an extracellular domain (aa 112-541), a transmembrane domain (aa 542-562), and a cytoplasmic domain (aa 563-582). MMP14 contains four hemopexin domains within its extracellular domain and a cysteine switch (aa 91-98). The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the release of propeptide activates the enzyme. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1J5, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt ~ 65.89 kDa, observed mol wt ~ 55 kDa species reactivity human, mouse packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, flow cytometry: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 -
Anti-MMP-9 Antibody, clone 8H12 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB2049-4X25UL ZRB2049-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 8H12 is a ZooMAb® Rabbit recombinant monoclonal antibody that specifically detects Matrix metalloproteinase-9 (MMP-9). It targets an epitope within 19 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 19 amino acids from the C-terminal region of human Matrix metalloproteinase-9 (MMP-9).ApplicationQuality Control Testing
Evaluated by Immunohistochemistry (Paraffin) in human bone marrow tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution of this antibody detected MMP-9 in human bone marrow tissue sections.
Tested applications
Affinity Binding Assay: A representative lot of this antibody bound MMP-9 with a KD of 8.3 x 10-9 in an affinity binding assay.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected MMP-9 in THP-1 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-MMP-9, clone 8H12 ZooMAb®, Cat. No. ZRB2049, is a recombinant Rabbit monoclonal antibody that targets MMP-9 and is tested for use in Affinity Binding Assay, Immunocytochemistry, and Immunohistochemistry (Paraffin).
Target description
Matrix metalloproteinase-9 (UniProt: P14780; also known as MMP-9, 92 kDa gelatinase, 92 kDa type IV collagenase, Gelatinase B, GELB) is encoded by the MMP9 (also known as CLG4B) gene (Gene ID: 4318) in human. MMP-9 is an extracellular or secreted enzyme that is synthesized as inactive proenzyme with a signal peptide (aa 1-19) and an activation peptide (aa 23-93) that are cleaved to generate the active enzyme. It is a zinc-binding enzyme that binds two zinc ions per subunit. MMP-9 contains a conserved cysteine that is present in the cysteine-switch motif and binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme. Processing of the precursor is reported to yield different active forms of 64, 67 and 82 kDa. It can be present as a monomer or a disulfide-linked homodimer. MMP-9 is produced by normal alveolar macrophages and granulocytes. Macrophages and transformed cells usually produce only the monomeric form. MMP-9 plays an essential role in local proteolysis of the extracellular matrix, in leukocyte migration, and bone osteoclastic resorption. It cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. MMP-9 expression is regulated by several cytokines and growth factors. In coordination with other MMPs, it plays a role in normal tissue remodeling events, including neurite growth, embryonic development, angiogenesis, ovulation, mammary gland involution and wound healing. Abnormalities in MMP-9 are associated with a variety of autoimmune diseases, including systemic lupus erythematosus, Sjogrens syndrome, systemic sclerosis, rheumatoid arthritis, multiple sclerosis, polymyositis and atherosclerosis. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры