Enhanced Validation Antibodies
- Сортировать:
- Вид таблицей
-
Anti-SYNM antibody produced in rabbit
Human Protein Atlas Number: HPA044200 Human Protein Atlas characterization data
Кат. номер HPA044200-100UL HPA044200-25UL Immunogensynemin, intermediate filament proteinApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87434,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) immunohistochemistry: 1:1000- 1:2500 immunogen sequence MDVSNVEAIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRSVISD conjugate unconjugated UniProt accession no. O15061, shipped in wet ice storage temp. 20°C Gene Information human ... SYNM(23336)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Synphilin-1 antibody produced in rabbit S5946-200UL
MDL number: MFCD02264134 NACRES: NA.41 General descriptionSynphilin-1 (synuclein a-interacting protein 1, SNCAIP), is a cytoplasmic protein that interacts with α-synuclein in neurons. Synphilin-1 contains several protein-protein interaction domains, including six ankyrin-like repeats, coiled-coil domain, and an ATP/GTP binding domain. The synphilin gene produces at least nine transcript variants encoding seven distinct proteins. Synphilin transcripts are widely expressed in many tissues with highest levels found in the brain, heart and placenta. Synphilin-1 is highly enriched in presynaptic nerve terminals.Immunogensynthetic peptide corresponding to amino acids 829-847 of human synphilin, conjugated to KLH. This sequence is identical in dog synphilin-1 and highly conserved (84% identity) in mouse, rat, and bovine synphilin-1.ApplicationAnti-Synphilin-1 antibody produced in rabbit has been used in co-immunoprecipitation and western blotting.
Biochem/physiol Actions
Synphilin-1 associates with and is ubiquitinated by several proteins, including α -synuclein, parkin, dorfin and siah E3 ubiquitin protein ligase 1 (SIAH1), and is a major component of Lewy bodies in Parkinson′s disease (PD). It is associated with synaptic vesicles and is modulated by α-synuclein. The central domain of synphilin-1 has been suggested to be required for the formation of aggregates and cytotoxicity. Synphilin-1 association with α -synuclein promotes the formation of cytosolic inclusions. Mutation of synphilin-1 in PD patients at amino acid R621C, is implicated in these sequestration, ubiquitination and proteasomal inhibition leading to increased accumulation of toxic intermediates. Cells with this mutation are more prone to staurosporine-induced cell death highlighting its cytoprotective functionality. In human postmortem brain tissue, synphilin-1, like a-synuclein is present in neurophil.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen 130 kDa species reactivity human enhanced validation recombinant expression concentration ~2 mg/mL application(s) western blot: 0.25-0.5 µg/mL using HEK-293 cells expressing human synphilin-1 conjugate unconjugated UniProt accession no. Q9Y6H5, shipped in dry ice storage temp. 20°C Gene Information human ... SNCAIP(9627)
mouse ... Sncaip(67847)
rat ... Sncaip(445354)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYNPO antibody produced in rabbit
Human Protein Atlas Number: HPA034631 Human Protein Atlas characterization data
Кат. номер HPA034631-100UL HPA034631-25UL Immunogensynaptopodin recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78602,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500 immunogen sequence TTPTKVYSEVHFTLAKPPSVVNRTARPFGIQAPGGTSQMERSPMLERRHFGEKAPAPQPPSLPDRSPRPQRHIMSRSPMVERRMMGQRS conjugate unconjugated UniProt accession no. Q8N3V7, shipped in wet ice storage temp. 20°C Gene Information human ... SYNPO(11346)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYNPO2 antibody produced in rabbit
Human Protein Atlas Number: HPA068563 Human Protein Atlas characterization data
Кат. номер HPA068563-100UL HPA068563-25UL Immunogensynaptopodin 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST92804,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:2500-1:5000 immunogen sequence DPNLSHDRIVHINSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAGLPRVEVILDCSDRQKTEGCRLQAGKECVDSPVEG conjugate unconjugated UniProt accession no. Q9UMS6, shipped in wet ice storage temp. 20°C Gene Information human ... SYNPO2(171024)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYNPO2L antibody produced in rabbit
Human Protein Atlas Number: HPA055192 Human Protein Atlas characterization data
Кат. номер HPA055192-100UL HPA055192-25UL Immunogensynaptopodin 2-likeApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85690,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence PAEALLLPHGPLRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAKLQRAESLQEKSIKEAKTKCRTIASLLTA conjugate unconjugated UniProt accession no. Q9H987, shipped in wet ice storage temp. 20°C Gene Information human ... SYNPO2L(79933)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYNPR antibody produced in rabbit
Human Protein Atlas Number: HPA061671 Human Protein Atlas characterization data
Кат. номер HPA061671-100UL HPA061671-25UL ImmunogensynaptoporinApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87933,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunohistochemistry: 1:50- 1:200 immunogen sequence DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSL conjugate unconjugated UniProt accession no. Q8TBG9, shipped in wet ice storage temp. 20°C Gene Information human ... SYNPR(132204)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYP antibody produced in rabbit
MDL number: MFCD02264139 Human Protein Atlas Number: HPA002858 Human Protein Atlas characterization data
Кат. номер HPA002858-100UL HPA002858-25UL ImmunogenSynaptophysin recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Synaptophysin (also known as the major synaptic vesicle protein p38) is a protein encoded by the SYP gene in humans. It is expressed in paneth cells, in goblet cells (in the mucus and cytoplasm) and in the neurons/synapses in the mucosa and submucosa. The gene plays a critical role in regulating neurotransmitter release and synaptic plasticity. It may be primarily associated with attention-deficit/hyperactivity disorder (ADHD). The gene is found to be involved in the susceptibility to schizophrenia. Abnormal expression of this gene in different brain regions may be linked to disorder in postmortem brain.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74355,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL conjugate unconjugated UniProt accession no. P08247, shipped in wet ice storage temp. 20°C Gene Information human ... SYP(6855)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-SYT1 antibody produced in rabbit
Human Protein Atlas Number: HPA064788 Human Protein Atlas characterization data
Кат. номер HPA064788-100UL HPA064788-25UL Immunogensynaptotagmin IApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86384,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
orthogonal RNAseq
independentapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELH conjugate unconjugated UniProt accession no. P21579, shipped in wet ice storage temp. 20°C Gene Information human ... SYT1(6857)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYT11 antibody produced in rabbit
Human Protein Atlas Number: HPA064091 Human Protein Atlas characterization data
Кат. номер HPA064091-100UL HPA064091-25UL Immunogensynaptotagmin XIApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88074,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence AEKKQKNPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGS conjugate unconjugated UniProt accession no. Q9BT88, shipped in wet ice storage temp. 20°C Gene Information human ... SYT11(23208)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYT16 antibody produced in rabbit HPA004199-100UL
Human Protein Atlas Number: HPA004199 Human Protein Atlas characterization data General descriptionSYT16 is a putative membrane trafficking protein belonging to the synaptotagmin (Syt) gene family. It is composed of a single N-terminal transmembrane domain and a putative fatty-acylation region adjacent to the transmembrane domain.ImmunogenSynaptotagmin-16 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
The activity of SYT16 (synaptotagmin XVI) is dependent on the Ca(2+) similar to all the members of Syt family proteins. It forms Ca(2+) independent oligomer. It may be involved in membrane and vesicular trafficking in specific tissues outside the brain.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70434,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence TRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLM conjugate unconjugated UniProt accession no. Q17RD7, shipped in wet ice storage temp. 20°C Gene Information human ... SYT16(83851)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYT4 antibody produced in rabbit HPA010574-100UL
Human Protein Atlas Number: HPA010574 Human Protein Atlas characterization data General descriptionSYT4 (synaptotagmin 4) gene is localized on human chromosome 18q12.3. Its mRNA is predominantly expressed in hippocampus of human brain, and shows lesser expression in amygdala and thalamus. This protein is a member of the SYT protein family. In PC12 (pheochromocytoma) cell line, it is expressed in endoplasmic reticulum-Golgi complexes and secretory granules. In culture neurons, this protein localizes to axonal processes. This protein forms a part of neuroendocrine system.Immunogensynaptotagmin IV recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
SYT4 (synaptotagmin 4) protein is thought to play a role in human brain functioning and neurological disorders. SYT4 null mice die shortly after birth. It is an atypical regulator of synaptic exocytosis, and also negatively controls the exocytosis of oxytocin. In dietary obesity, there is an increased vesicle binding of SYT4, which leads to increased negative regulation of oxytocin exocytosis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71943,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMT conjugate unconjugated UniProt accession no. Q9H2B2, shipped in wet ice storage temp. 20°C Gene Information human ... SYT4(6860)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYT5
Кат. номер HPA078390-100UL HPA078390-25UL ImmunogenRecombinant protein corresponding to synaptotagmin 5
Sequence
CRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPSApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human (2806) packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50-1:200 conjugate unconjugated UniProt accession no. O00445, shipped in wet ice storage temp. 20°C Gene Information human ... SYT5(6861)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYT7 antibody produced in rabbit
Human Protein Atlas Number: HPA012869 Human Protein Atlas characterization data
Кат. номер HPA012869-100UL HPA012869-25UL General descriptionSynaptotagmin-7 (SYT7) belongs to the Syt family and is found on the membrane of lysosomes and non-synaptic secretory granules. It contains a short amino-terminal ectodomain, a transmembrane region and two highly conserved Ca2+-binding C2 domains (C2A and C2B). The gene encoding this protein is localized on chromosome 11q12-q13.1.ImmunogenSynaptotagmin-7 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Synaptotagmin-7 (SYT7) is involved in the regulation of synaptic vesicle Ca2+-triggered exocytosis and plasma membrane repair. Three Aspartate residues in the Ca2+-binding loop of SYT7 (Asp-172, Asp-303, and Asp-357) are very important to initiate oligomerization in SYT7. This oligomerization is important for the efficient functioning of SYT7.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71619,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence NSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLP conjugate unconjugated UniProt accession no. O43581, shipped in wet ice storage temp. 20°C Gene Information human ... SYT7(9066)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYTL1 antibody produced in rabbit
Human Protein Atlas Number: HPA037825 Human Protein Atlas characterization data
Кат. номер HPA037825-100UL HPA037825-25UL Immunogensynaptotagmin-like 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76818,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:500- 1:1000 immunogen sequence EAIAGVLQRDARLRQLEEGRVSKLRASVADPGQLKILTGDWFQEARSQRHHNAHFGSDLVRASMRRKKSTRGDQAPGHDREAEAAVKEK conjugate unconjugated UniProt accession no. Q8IYJ3, shipped in wet ice storage temp. 20°C Gene Information human ... SYTL1(84958)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYTL4 antibody produced in rabbit
Human Protein Atlas Number: HPA001589 Human Protein Atlas characterization data
Кат. номер HPA001589-100UL HPA001589-25UL Immunogensynaptotagmin-like 4 recombinant protein epitope signature tag (PrEST).ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
SYTL4 (Synaptotagmin-like protein 4) gene encodes a protein belonging to the synaptotagmin like protein family. These proteins consist of an N-terminal Rab27 binding domain and C-terminal tandem C2 domain. The C-terminal domain binds to Ca2+ and phospholipids trafficking the secretory vesicles to the plasma membrane. SYTL4 protein binds certain Rab GTPases and functions in intracellular membrane trafficking. It regulates exocytosis of dense-core granules by interacting with Rab27.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74286,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation RNAi knockdown application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence RLKNELLEIKRKGAKRGSQHYSDRTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFYDQKVNRFAYRTGSEIIRMSLRHKPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQKEPSVLFEVP conjugate unconjugated UniProt accession no. Q96C24, shipped in wet ice storage temp. 20°C Gene Information human ... SYTL4(94121)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SYVN1 antibody produced in rabbit
Human Protein Atlas Number: HPA024300 Human Protein Atlas characterization data
Кат. номер HPA024300-100UL HPA024300-25UL ImmunogenE3 ubiquitin-protein ligase synoviolin Precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70752,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) immunohistochemistry: 1:500- 1:1000 immunogen sequence HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGP conjugate unconjugated UniProt accession no. Q86TM6, shipped in wet ice storage temp. 20°C Gene Information human ... SYVN1(84447)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-SZRD1 antibody produced in rabbit
Human Protein Atlas Number: HPA024221 Human Protein Atlas characterization data
Кат. номер HPA024221-100UL HPA024221-25UL ImmunogenUPF0485 protein C1orf144 (Putative MAPK-activating protein PM18/PM20/PM22) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76500,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:1000-1:2500 immunogen sequence PNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQR conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... C1orf144(26099)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TAC3 antibody produced in rabbit
Human Protein Atlas Number: HPA045919 Human Protein Atlas characterization data
Кат. номер HPA045919-100UL HPA045919-25UL Immunogentachykinin 3 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST81150,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence GAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLM conjugate unconjugated UniProt accession no. Q9UHF0, shipped in wet ice storage temp. 20°C Gene Information human ... TAC3(6866)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TACC2 antibody produced in rabbit HPA031021-100UL
Human Protein Atlas Number: HPA031021 Human Protein Atlas characterization data Immunogentransforming, acidic coiled-coil containing protein 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87035,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200-1:500","western blot: 0.04-0.4 µg/mL immunogen sequence ESPCPVGEPPLALENAASLKLFAGSLAPLLQPGAAGGEIPAVQASSGSPKARTTEGPVDSMPCLDRMPLLAKGKQATGEEKAATAPGA conjugate unconjugated UniProt accession no. O95359, shipped in wet ice storage temp. 20°C Gene Information human ... TACC2(10579)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TACC3 antibody produced in rabbit HPA005781-100UL
Human Protein Atlas Number: HPA005781 Human Protein Atlas characterization data ImmunogenTransforming acidic coiled-coil-containing protein 3 recombinant protein epitope signature tag (PrEST)ApplicationAnti-TACC3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Transforming acidic coiled-coil-containing protein 3 is a protein encoded by the TACC3 gene in humans. It is referred as ERIC1 and ERIC-1. It is a member of the human transforming acidic coiled-coil (TACC) family of centrosomal adaptor proteins. It plays a critical role in microtubule nucleation at the centrosome. It is involved in the regulation of microtubule nucleation at the centrosome and functions in the stabilization of the γ-tubulin ring complex assembly. It plays an essential role in spindle assembly and centrosome integrity during mitosis as well as for cellular survival. It may act as a potential therapeutic target in cancer cells. It is aberrantly expressed in a variety of human cancers. It acts as a driver of tumorigenesis as well as an inducer of oncogenic EMT.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70194,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation RNAi knockdown application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN conjugate unconjugated UniProt accession no. Q9Y6A5, shipped in wet ice storage temp. 20°C Gene Information human ... TACC3(10460)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TACO1 antibody produced in rabbit HPA024294-100UL
Human Protein Atlas Number: HPA024294 Human Protein Atlas characterization data ImmunogenCoiled-coil domain-containing protein 44 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75707,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation independent
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:20-1:50 immunogen sequence SNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMAIEAGAEDVKETEDE conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... CCDC44(51204)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TACSTD2 antibody produced in rabbit
Human Protein Atlas Number: HPA043104 Human Protein Atlas characterization data
Кат. номер HPA043104-100UL HPA043104-25UL Immunogentumor-associated calcium signal transducer 2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83800,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
recombinant expressionapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence SGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGL conjugate unconjugated UniProt accession no. P09758, shipped in wet ice storage temp. 20°C Gene Information human ... TACSTD2(4070)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TAF15 antibody produced in rabbit
Human Protein Atlas Number: HPA063647 Human Protein Atlas characterization data
Кат. номер HPA063647-100UL HPA063647-25UL ImmunogenTAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDaApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST92386,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation RNAi knockdown application(s) immunofluorescence: 0.25-2 µg/mL","western blot: 0.04-0.4 µg/mL immunogen sequence SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY conjugate unconjugated UniProt accession no. Q92804, shipped in wet ice storage temp. 20°C Gene Information human ... TAF15(8148)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-TAF7 antibody produced in rabbit HPA006429-100UL
Human Protein Atlas Number: HPA006429 Human Protein Atlas characterization data General descriptionTAF7 (TATA-box binding protein associated factor 7) gene is localized to human chromosome 5q31. It is a part of the multi-subunit transcription factor TFIID. It was initially recognized as TBP-associated factor (TAFII) of TFIID, which is specific for RNA polymerase II.ImmunogenTranscription initiation factor TFIID subunit 7 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
TAF7 (TATA-box binding protein associated factor 7) acts as a transcriptional repressor, where it binds to TAF1, and prevents its acetyl transferase activity. This activity is necessary for the basal transcription of MHC (major histocompatibility class) I. It acts as a regulator of check-point and prevents premature initiation of transcription until the preinitiation complex (PIC) is assembled completely. It interacts with multiple transcription factors such as, Sp1 (specificity protein), YY1 (Yin Yang 1), USF (upstream transcription factor 1), CTF (C-terminal fragment), adenovirus E1A, and HIV-1 (human immunodeficiency virus) Tat (trans-activator of transcription). It is also involved in the activation of thyroid hormone and vitamin D3 receptor in a ligand-independent fashion. It might also be involved in the processing of the 3′ end of mRNA.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70992,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence ISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKN conjugate unconjugated UniProt accession no. Q15545, shipped in wet ice storage temp. 20°C Gene Information human ... TAF7(6879)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TAF8 antibody produced in rabbit HPA031730-100UL
Human Protein Atlas Number: HPA031730 Human Protein Atlas characterization data ImmunogenTAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDaApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87054,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence PHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYL conjugate unconjugated UniProt accession no. Q7Z7C8, shipped in wet ice storage temp. 20°C Gene Information human ... TAF8(129685)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TAGLN antibody produced in rabbit
Human Protein Atlas Number: HPA019467 Human Protein Atlas characterization data
Кат. номер HPA019467-100UL HPA019467-25UL General descriptionThe gene TAGLN (transgelin) is mapped to human chromosome 11q23.2. It belongs to the calponin family. The protein is strongly expressed in the smooth muscle tissues.ImmunogenTransgelin recombinant protein epitope signature tag (PrEST)ApplicationAnti-TAGLN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
TAGLN (transgelin) is an actin stress fiber binding protein. It is mainly involved in cell growth, differentiation, invasion, muscle fiber contractility and matrix remodeling. TAGLN is up-regulated in osteosarcoma cell lines, colorectal adenocarcinoma, prostate , hepatocellular , gastric, pancreatic and colon cancer. However, it is down-regulated in urinary bladder, renal cell carcinoma and colorectal cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74706,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV conjugate unconjugated UniProt accession no. Q01995, shipped in wet ice storage temp. 20°C Gene Information human ... TAGLN(6876)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TAGLN Antibody, clone 1D10 , ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1211-4X25UL ZRB1211-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 1D10 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Transgelin. It targets an epitope within 12 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 12 amino acids from the C-terminal region of human Transgelin.ApplicationAnti-TAGLN, clone 1D10 ZooMAb, Cat. No. ZRB1211, is a highly specific recombinant rabbit monoclonal antibody that detects Transgelin/SM22 alpha and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected TAGLN in HEPG2, NIH-3T3, and human skeletal muscle lysates.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected TAGLN in human uterus tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected TAGLN in C2C12 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens and experimental conditions may vary.
Target description
Transgelin (UniProt: Q01995; also known as 22 kDa actin-binding protein, Protein WS3-10, Smooth muscle protein 22-alpha, SM22-alpha) is encoded by the TAGLN (also known as SM22, WS3-10) gene (Gene ID:6876) in human. Transgelin is a shape change sensitive actin-binding protein of the calponin family that contains a calponin-homology domain (aa 24-137) and a C-terminal calponin-like module (aa 175-200) that is essential for actin binding. It is found in vascular and visceral smooth muscles of all adult vertebrates and is considered as an early marker of smooth muscle differentiation. Transgelin expression has also been reported in fibroblasts, spinal cord, adrenal gland, and in several immune cells. It is overexpressed in senescent human fibroblasts. It is shown to be transiently expressed in heart and skeletal muscle cells during early embryogenesis in mouse. Transgelin serves as an actin stress fiber-associated protein that stabilizes actin gels in vitro. It is reported to promote podosome formation and contributes to cell motility in response to injury or inflammation. Activation of TGF 1 signaling is shown to induce Transgelin expression, which enhances mesenchymal stem cells (MSC) differentiation and migration. Over-expression of Transgelin is shown to enhance osteoblast and adipocyte differentiation of MSC and these effects are abolished in the presence of TGF beta signaling inhibitors. Elevated levels of Transgelin are reported to promote tumor metastasis and are correlated with aggressive tumor behavior and poor prognosis in colorectal cancers. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Assinder, SJ et al. (2009). Int. J. Biochem. Cell Biol. 41(3); 482-486; Elsafadi, M., et al. (2016). Cell Death and Disease 7; e2321; Zhou, H-M., et al. (2016). BMC Cancer. 16: 55).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Stable for 1 year at 2-8°C from date of receipt.Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1D10, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 22.61 kDa, observed mol wt ~22 kDa species reactivity mouse, human species reactivity (predicted by homology) rat, bovine packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-TAGLN3 antibody produced in rabbit
Human Protein Atlas Number: HPA062620 Human Protein Atlas characterization data
Кат. номер HPA062620-100UL HPA062620-25UL Immunogentransgelin 3ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87979,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence EQKYDADLENKLVDWIILQCAEDIEHPP conjugate unconjugated UniProt accession no. Q9UI15, shipped in wet ice storage temp. 20°C Gene Information human ... TAGLN3(29114)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-TALDO1 antibody produced in rabbit HPA048089-100UL
Human Protein Atlas Number: HPA048089 Human Protein Atlas characterization data Immunogentransaldolase 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST89556,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation independent application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL immunogen sequence FVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGEL conjugate unconjugated UniProt accession no. P37837, shipped in wet ice storage temp. 20°C Gene Information human ... TALDO1(6888)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Talin-1 Antibody, clone 2F8 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1361-4X25UL ZRB1361-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.SpecificityClone 2F8 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Talin-1. It targets an epitope within 17 amino acids from the C-terminal half.ImmunogenKLH-conjugated linear peptide corresponding to 17 amino acids from the C-terminal half of human Talin-1.ApplicationQuality Control Testing
Evaluated by Western Blotting in K562 cell lysate.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected Talin-1 in K562 cell lysate.
Tested applications
Western Blotting Analysis: A 1:10,000 dilution from a representative lot detected Talin-1 in Cos-7 cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected Talin-1 in human tonsil tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Talin-1 in HeLa, A431, HepG2, NIH 3T3 and Jurkat cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Talin-1, clone 2F8 ZooMAb®, Cat. No. ZRB1361, is a recombinant Rabbit monoclonal antibody that specifically detects Talin-1 and is tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Talin-1 (UniProt: Q9Y490) is encoded by the TLN1 (also known as KIAA1027, TLN) gene (Gene ID: 7094) in human. Talin-1 is a peripheral membrane protein that localized in adhesion complexes between cells and the extracellular matrix. It is shown to colocalize with layilin at the membrane ruffles and localized preferentially in focal adhesions than fibrillar adhesions. Talin-1 is involved in connections of major cytoskeletal structures to the plasma membrane. It binds to and activates integrins, directly connecting integrins to the actin cytoskeleton and recruiting numerous proteins, such as vinculin and focal adhesion kinase into integrin adhesion complexes. Talin-1 contains a globular N-terminal head region and a flexible rod domain, which can be dissociated by the action of calpain 2. The head region contains a FERM (protein 4.1, ezrin, radixin, moesin) domain that has binding sites for the cytoplasmic domains of -integrins, layilin, and F-actin. The head region is also known to bind PIPK1 90 and the focal adhesion kinase. The rod domain is known to have an additional integrin-binding site, two actin-binding sites, and several binding sites for vinculin. Talin-1 expression is upregulated in several human cancers and accelerates tumor cell migration and metastasis. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Ji, L., et al. (2019). Oncol. Lett. 18(5); 5408-5416; David R. Critchley, DR., and Gingras, AR. (2008). J. Cell Sci. 121(9); 1345-1347).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры
