Anti-B4GALT3 antibody produced in rabbit

Human Protein Atlas Number:

HPA010793    Human Protein Atlas characterization data

Кат. номер

HPA010793-100UL

HPA010793-25UL

B4GALT3 (UDP-Gal:GlcNAc 1,4- galactosyltransferase, polypeptide 3) belongs to a family of seven members, called -1,4-galactosyltransferase (-1,4-GalT). It is expressed in a wide range of human tissues. Its expression in fetal brain is much higher than that in adult brain. This gene is located on human chromosome 1q23. The coding region of this gene consists of one initiation codon, preceding a sequence coding for a putative hydrophobic transmembrane region. The predicted encoded protein is a type II transmembrane protein, containing a cytoplasmic N-terminal of four residues. It has a stem region, an eighteen residue transmembrane region, and a catalytic domain made of 371 amino acids, containing four potential N-linked glycosylation sites.
β-1,4-Galactosyltransferase 3 recombinant protein epitope signature tag (PrEST)
Anti-B4GALT3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
B4GALT3 (UDP-Gal:GlcNAc 1,4- galactosyltransferase, polypeptide 3) enzyme catalyzes the synthesis of poly-N-acetyllactosamine. However, its extension capacity of poly-N-acetyllactosamine is poor, and it adds the first galactose residue to poly-N-acetyllactosamine chain. It enhances metastasis and invasiveness of neuroblastoma cells, via the modulation of signaling and glycosylation of 1-integrin. It is overexpressed in neuroblastoma cells, and predicts poor prognosis for the same. B4GALT3 expression is also negatively correlated with metastasis in colorectal cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72092,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	mouse, human
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS
conjugate	unconjugated
UniProt accession no.	O60512,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... B4GALT3(8703)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1