Anti-CTGF antibody produced in rabbit HPA031074-100UL

Human Protein Atlas Number:

HPA031074    Human Protein Atlas characterization data

The CTGF (connective tissue growth factor) gene is mapped to human chromosome 6q23.2. The encoded protein contains five domains namely, secretory signal peptide, insulin-like growth factor-binding protein, von Willebrand factor type C repeat, thrombospondin type-1 repeat and C-terminal cystine-knot-containing domain. Th gene is broadly expressed in many cells including fibroblasts, myofibroblasts, endothelial cells, smooth muscle cells and some epithelial cell types. It is either released to extracellular matrix or is located on the cell membrane.
connective tissue growth factor recombinant protein epitope signature tag (PrEST)
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Anti-CTGF antibody produced in rabbit has been used in immunohistochemistry.
Biochem/physiol Actions
CTGF (connective tissue growth factor) regulates cell communication with the extracellular matrix also inducing collagen deposition, stimulation and differentiation of mesenchymal cells and tissue remodeling. Abnormal expression of CTGF is associated with pathological conditions such as arthritis, fibrosis, and cancers. CTGF might control epithelial-mesenchymal transition, a signal pathway that contains an important step associated with tumor cell metastasis, in many types of cancer. Overexpression of CTGF enhances esophageal squamous cell carcinoma by associating with TGF-β (transforming growth factor β) pathway. It is involved in the development of fibrotic tissues in different types of organs. Overexpression of CTGF leads to fibrosis in many disease condition. Overexpression of CTGF is observed in joint capsule during joint contracture. CTGF is associated with inflammation reactions and controls macrophage adhesion and migration.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST77407,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
application(s)	immunoblotting: None","immunofluorescence: 1-4 µg/mL","immunohistochemistry: 1:20- 1:50
immunogen sequence	CTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLC
conjugate	unconjugated
UniProt accession no.	P29279,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... CTGF(1490)

RIDADR	NONH for all modes of transport
WGK Germany	1