Anti-DDX47 antibody produced in rabbit HPA014855-100UL

Human Protein Atlas Number:

HPA014855    Human Protein Atlas characterization data

DDX47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47) is a member of the DEAD box protein family, and shares homology with the members at its N-terminal. It has the eight motifs characteristic of DEAD box member proteins, such as Walker A and Walker B motifs. It resides in the nucleolus, but shuttles between cytoplasm and nucleus. During cell division, it is found almost entirely in the cytoplasm. It has a molecular weight of 66kDa. It has a wide range of tissue expression including retina, liver, testis, placenta and T-cells.
Probable ATP-dependent RNA helicase DDX47 recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
The exact function of DDX47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47) is not well understood, but it is thought that this protein plays a role in the biosynthesis of ribosomes. This protein interacts with the C-terminal of the E1E4 protein of human papillomavirus type 16 (HPV16), and might be involved in the replication of HPV16. This protein is also a binding partner of GABA(A) receptor-associated protein (GABARAP), which acts a chaperone for GABA (γ-aminobutyric aid)(A) receptor in the neurons of cortex. Together, GABARAP and DDX47 might be involved in apoptosis. DDX47 is involved in the processing of pre-rRNA, and is recruited to the pre-rRNA processing region by NOP132 (nucleolar protein).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73083,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	rat, mouse, human
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
conjugate	unconjugated
UniProt accession no.	Q9H0S4,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... DDX47(51202)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable