Anti-DHRS3 antibody produced in rabbit

Human Protein Atlas Number:

HPA010844    Human Protein Atlas characterization data

Кат. номер

HPA010844-100UL

HPA010844-25UL

DHRS3 (dehydrogenase/reductase member 3) is an all-trans-retinol dehydrogenase, which belongs to short-chain dehydrogenase/reductase (SDR) family. This gene is localized to human chromosome 1p35.1.7 and is widely expressed in multiple adult and fetal tissues. However, it is predominantly expressed in cone photoreceptors. The mRNA for DHRS3 is absent in brain. DHRS3 contains the motifs characteristic of SDR family such as, YXXXK motif, the catalytic Ser-175 residue, the serine residue before Ly-192 which is highly conserved, TGXXXGXG motif which is a nucleotide binding motif and is highly conserved.
Short-chain dehydrogenase/reductase 3 recombinant protein epitope signature tag (PrEST)
Anti-DHRS3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
DHRS3 (dehydrogenase/reductase member 3) has a supposed role in the metabolism of retinoid and lipid. In cone photoreceptors, it regulates the conversion of retinal to retinol in the visual cycle. However, its wide expression in multiple human tissues, suggest that DHRS3 might play a general part in the metabolism of retinol. It acts as an all-trans-retinaldehyde-specific reductase, and becomes completely active only after activation by retinol dehydrogenase 10 (RDH10). It thus, reduces the rate of retinoic acid synthesis, by converting retinal back to retinol. In neuroblastoma (NB) cells which show overexpression of MYCN (v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog), DHRS3 is usually deleted, which leads to compromised sensitivity of NB cells to retinol. Thus, DHRS3 might be responsible for tumorigenesis of NB and its progression. It is suggested that DHRS3 also plays a role in developmental processes and tumor suppression via p53 and p63 pathway.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72127,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human, rat, mouse
packaging	antibody small pack of 25 µL
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPG
conjugate	unconjugated
UniProt accession no.	O75911,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... DHRS3(9249)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable