Производитель может поднять цены — запросите коммерческое предложение сейчас, и мы зафиксируем за вами текущую цену.
-
Привезем под заказ -
Срок поставки с завода 6-8 недель
- Производитель:
- Sigma-Aldrich
| Human Protein Atlas Number: | HPA025062 Human Protein Atlas characterization data |
| Кат. номер |
| HPA025062-100UL |
| HPA025062-25UL |
General description
The gene SLCO5A1 (solute carrier organic anion transporter family member 5A1) is mapped to human chromosome 8q13.3. The mRNA is expressed in the brain, heart, skeletal muscle and ovary. In addition, it is also expressed in bone tumors, prostate cancer, breast cancer, drug-resistant small cell lung cancer and liver cancer. The SLCO5A1 protein belongs to the OATP5 (organic anion-transporting polypeptide 5) family of proteins. The protein has 12 transmembrane domains and shows different localization depending on the tissue. Immunogen
Solute carrier organic anion transporter family member 5A1 recombinant protein epitope signature tag (PrEST)Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.Anti-SLCO5A1 antibody produced in rabbit has been used in Western blotting, immunofluorescence and flow cytometry.
Biochem/physiol Actions
SLCO5A1 (solute carrier organic anion transporter family member 5A1) might be involved in cellular responses associated with the reorganization of the cell morphology, for instance differentiation and migration.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST76253,.Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметры
| biological source | rabbit |
| Quality Level | 100 |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| packaging | antibody small pack of 25 µL |
| application(s) | immunohistochemistry: 1:20- 1:50 |
| immunogen sequence | SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM |
| conjugate | unconjugated |
| UniProt accession no. | Q9H2Y9, |
| shipped in | wet ice |
| storage temp. | 20°C |
| Gene Information | human ... SLCO5A1(81796) |
Safety Information
| RIDADR | NONH for all modes of transport |
| WGK Germany | WGK 1 |
| Flash Point F | Not applicable |
| Flash Point C | Not applicable |
Пуско-наладка
Выполним распаковку, визуальную проверку, сборку и установку, запуск и настройку, проверку функциональности, проведем инструктаж персонала.
Техническое обслуживание
Проведем периодические регламентные работы: визуальный осмотр, очистка засоренных узлов и частей, замена расходных материалов и изношенных деталей, тестирование прибора, проверка показателей и измерение параметров, калибровка и настройка, обновление программного обеспечения.
IQ/OQ/PQ квалификация, валидация
Проведем монтажную (IQ), операционную (OQ) и эксплуатационную (PQ) квалификацию оборудования по протоколам производителя в полном соответствии с стандартами GMP/GLP.
Ремонт
Проведем диагностику в нашем сервисном центре или у Вас на предприятии, выявим причину поломки, устраним неисправность, проведем тестирование, настройку, калибровку отремонтированного оборудования.
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
Отзывы
В числе наших клиентов организации
из разных отраслей
Производитель может поднять цены — запросите коммерческое предложение сейчас, и мы зафиксируем за вами текущую цену.
-
Привезем под заказ
-
Срок поставки с завода 6-8 недель
