Anti-TAF12 antibody produced in rabbit

Human Protein Atlas Number:

HPA008519    Human Protein Atlas characterization data

Кат. номер

HPA008519-100UL

HPA008519-25UL

Transcription initiation factor TFIID subunit 12 (TAF12) is a TBP-associated factor (TAFs). It it a subunit of TFIID and SPT3-TAFII31-GCN5L acetylase (STAGA ) complexes. It contains a histone-fold domain (HFD) which possesses DNA binding capacity.
Transcription initiation factor TFIID subunit 12 recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Transcription initiation factor TFIID subunit 12 (TAF12) interacts with cyclic AMP-dependent transcription factor (ATF7), which is modulated by TBP-associated factor 4 (TAF4). It mediates the transcriptional activity of ATF7 where the N-terminal domain of ATF7 and the histone-fold domain (HFD) of TAF12 interact with each other to form a heterodimer. This increases the stability of the complex with the DNA. Along with the complex of TFIID and various other proteins, TAF12 mediates the regulation of RNA polymerase transcription. There is a formation of a nucleosome-like substructure within TFIID which has a tetramer of TAF6 and TAF9 along with homodimers of TAF12.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70900,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunohistochemistry: 1:20- 1:50
immunogen sequence	NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIR
conjugate	unconjugated
UniProt accession no.	Q16514,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... TAF12(6883)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable