Anti-TMEM120B antibody produced in rabbit

Human Protein Atlas Number:

HPA014066    Human Protein Atlas characterization data

Кат. номер

HPA014066-100UL

HPA014066-25UL

Transmembrane protein 120B recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
The gene TMEM120B (Transmembrane protein 120B) encodes a nuclear envelope transmembrane protein that is found to be expressed along with TMEM120A protein in fat. When tested in the 3T3-L1 in vitro adipogenesis system, both TMEM120A and B were found to be induced very early in 3T3-L1 adipogenesis. Knockdown of TMEM120B affected genes involved in adipogenesis more adversely than reduction of TMEM120A. Knockdown of both the genes resulted in an additive effect. Overexpression of TMEM120B was found to have a lesser effect on the rescue of adipogenesis than the increased expression of TMEM120A under conditions of double knockdown. Both the genes play significant roles in adipocyte differentiation and may be involved in disorders of obesity.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72437,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	THRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANIKERQDVFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKD
conjugate	unconjugated
UniProt accession no.	A0PK00,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... TMEM120B(144404)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable