Human Protein Atlas Number: | HPA018327 Human Protein Atlas characterization data |
Кат. номер |
HPA018327-100UL |
HPA018327-25UL |
The gene casitas B-lineage lymphoma proto-oncogene b (CBLB) is mapped to human chromosome 3q13.11. It belongs to CBL family of ubiquitin ligases.
E3 ubiquitin-protein ligase CBL-B recombinant protein epitope signature tag (PrEST)
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Casitas B-lineage lymphoma proto-oncogene b (CBLB) is phosphorylated upon T cell receptor (TCR) stimulation and is involved in TCR-mediated intracellular signaling pathways. Similarly, phosphorylated CBLB is recruited to epidermal growth factor receptor (EGFR) upon EGF stimulation and inhibits EGF-induced cell growth. CBLB interacts with CIN85 (SH3 domain-containing kinase-binding protein 1) and together they regulate EGF receptor endocytosis and down-regulation of the activated receptor. CBLB participates in controlling T-cell activation thresholds by negative regulation of Vav, a GDP/GTP exchange factor. The molecular mechanism involves CBLB-mediated degradation of p85 regulatory subunit of phosphatidylinositol 3-kinase, an upstream regulator of Vav. CBLB is associated with an autoimmune disease of the central nervous system, multiple sclerosis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Corresponding Antigen APREST73956,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
biological source | rabbit |
Quality Level | 100 |
antibody form | affinity isolated antibody |
antibody product type | primary antibodies |
clone | polyclonal |
product line | Prestige Antibodies® Powered by Atlas Antibodies |
form | buffered aqueous glycerol solution |
species reactivity | human |
packaging | antibody small pack of 25 µL |
application(s) | immunohistochemistry: 1:50- 1:200 |
immunogen sequence | PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKP |
conjugate | unconjugated |
UniProt accession no. | Q13191, |
shipped in | wet ice |
storage temp. | 20°C |
Gene Information | human ... CBLB(868) |
Personal Protective Equipment | Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), |
RIDADR | NONH for all modes of transport |
WGK Germany | WGK 1 |
Flash Point F | Not applicable |
Flash Point C | Not applicable |