Protein Biology
- Сортировать:
- Вид таблицей
-
Anti-HBQ1 antibody produced in rabbit
Human Protein Atlas Number: HPA062473 Human Protein Atlas characterization data
Кат. номер HPA062473-100UL HPA062473-25UL Immunogenhemoglobin, theta 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87968,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500 immunogen sequence RHYPGDFSPALQASLDKFLSHVISALVSEYR conjugate unconjugated UniProt accession no. P09105, shipped in wet ice storage temp. 20°C Gene Information human ... HBQ1(3049)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HBS1L antibody produced in rabbit
Human Protein Atlas Number: HPA029729 Human Protein Atlas characterization data
Кат. номер HPA029729-100UL HPA029729-25UL ImmunogenHBS1-like translational GTPaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77369,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity rat, human, mouse packaging antibody small pack of 25 µL enhanced validation RNAi knockdown application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence RNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEI conjugate unconjugated UniProt accession no. Q9Y450, shipped in wet ice storage temp. 20°C Gene Information human ... HBS1L(10767)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HCF-1 Antibody, clone 1B17 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1460-4X25UL ZRB1460-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.SpecificityClone 1B17 is a ZooMAb® rabbit recombinant monoclonal antibody that detects Host cell factor 1. It targets an epitope within 23 amino acids from the C-terminal, chain-6 region. It detects all C-terminal cleavage chains.ImmunogenKLH-conjugated linear peptide corresponding to 23 amino acids from the C-terminal, chain-6 region of human Host cell factor 1 (HCF-1).ApplicationAnti-HCF-1, clone 1B17 ZooMAb®, Cat. No. ZRB1460, is a recombinant Rabbit monoclonal antibody that targets HCF-1 and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected HCF-1 in HeLa cell lysate.
Tested applications
Western Blotting Analysis: A 1:10,000 dilution from a representative lot detected HCF-1 in lysates from rat brain, A549 cells and NIH3T3 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected HCF-1 in human colon tissue sections.
Immunocytochemistry Analysis: A 1:1,000 dilution from a representative lot detected HCF-1 in NIH3T3 cells.
Affinity Binding Assay: A representative lot of this antibody bound HCFC1 with a KD of 6.1 x 10-7 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Host cell factor 1 (UniProt: P51610; also known as HCF, HCF-1, C1 factor, CFF, VCAF, VP16 accessory protein) is encoded by the HCFC1 (also known as HCF1, HFC1) gene (Gene ID: 3054) in human. HCF-1, a cellular transcription factor and co-activator that is required for progression through the G1 phase of the cell cycle. It is a heterodimeric complex that contains six N-terminal and six C-terminal chains that remain tightly associated in a non-covalent manner. It also contains eight HCF repeats that are specific proteolytic cleavage signals. This complex is proteolytically cleaved into one or several PPCE THET sites within the HCF repeats. HCF-1 does not bind to DNA directly, however, both N- and C-terminal chains are shown to associate with DNA. The Kelch domains in the N-terminal region recognize and associate with HCF-binding motif present in many sequence-specific DNA-binding factors. HCF-1 is reported to act in concert with E2F1 to activate transcription of S phase genes. It recruits KMT2E/MLL5 to E2F1 responsive promoters that facilitate transcriptional activation and G1 to S phase transition. HCF-1 is highly expressed in fetal tissues and the adult kidney. However, its expression is reported in many tested tissues. Mutations in HCFC1 gene have been linked to X-linked 3 mental retardation. In addition, a single point mutation in the Kelch domain (P134S) is reported to cause a temperature-induced cell-proliferation arrest and cytokinesis defects. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Zhou, P., et al. (2013). J. Biol. Chem. 288(24); 17532-17543; Zargar, ZU, and Tyagi, S. (2012). Transcription. 3(4); 187-192; Tyagi, S., et al. (2007). Mol. Cell. 27(1); 107-119; Vogel, JL., and Kristie, TM. (2000). Proc. Natl. Acad. Sci. USA. 97(17); 9425-9430).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rabbit recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1B17, recombinant monoclonal description recombinant, expressed in HEK 293 cells product line ZooMAb® form lyophilized mol wt calculated mol wt 208.73 kDa","observed mol wt ~70 to 210 kDa species reactivity rat, mouse, human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) affinity binding assay: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG epitope sequence C-terminus conjugate unconjugated Protein ID accession no. NP_005325, UniProt accession no. P51610, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HDAC1 antibody produced in rabbit
MDL number: MFCD01633420 Human Protein Atlas Number: HPA029693 Human Protein Atlas characterization data
Кат. номер HPA029693-100UL HPA029693-25UL Immunogenhistone deacetylase 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78153,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
RNAi knockdownapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence RIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKE conjugate unconjugated UniProt accession no. Q13547, shipped in wet ice storage temp. 20°C Gene Information human ... HDAC1(3065)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HDAC1 Antibody, clone 4D21 , ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1231-4X25UL ZRB1231-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 4D21 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Histone Deacetylase 1. It targets an epitope within 17 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 17 amino acids from the C-terminal region of human Histone Deacetylase 1.ApplicationAnti-HDAC1, clone 4D21 ZooMAb, Cat. No. ZRB1231, is a recombinant Rabbit monoclonal antibody that specifically targets Histone deacetylase 1 and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected HDAC1 in A431 and NIH/3T3 cell lysates.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected HDAC1 in human small intestine and mouse colon tissue sections.
Immunocytochemistry Analysis: A 1:1,000 dilution from a representative lot detected HDAC1 in HeLa, A431, HUVEC, and NIH 3T3 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user.
Target description
Histone deacetylase 1 (UniProt: Q13547; also known as EC:3.5.1.98, HD1, HDAC1) is encoded by the HDAC1 (also known as RPD3L1) gene (Gene ID: 3065) in human. HDAC1, a member of Class I HDACs is widely expressed in tissues and is primarily located in the nucleus. Higher expression of HDAC1 is observed in heart, pancreas, and testis. It catalyzes the removal of the acetyl moiety from the -amino groups of lysine residues of histones to yield deacetylated histones H2A, H2B, H3 and H4, which results in compaction of chromatin into a transcriptionally repressed state. HDAC1 is a component of the BRG1-RB1-HDAC1 complex, which is reported to negatively regulate the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. HDAC1 is also shown to deacetylate lysine 310 in RelA and thereby inhibits the transcriptional activity of NF-kappa-B. HDAC1 undergoes sumolyation on lysine 444 and lysine 476, which promotes its enzymatic activity. In addition, phosphorylation on serine 421 and serine 423 by Cdk5 also promotes its activity and interactions with nucleosome remodeling and deacetylase (NuRD) and SIN3 complexes. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 4D21, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 55.10 kDa, observed mol wt ~60 kDa species reactivity human, mouse packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-HDAC2 antibody produced in rabbit
MDL number: MFCD02096533 Human Protein Atlas Number: HPA011727 Human Protein Atlas characterization data
Кат. номер HPA011727-100UL HPA011727-25UL ImmunogenHistone deacetylase 2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
HDAC2 (Histone deacetylase 2) is a chromatin modifier localized in the nucleus along with other tissues and cell types. It plays a vital role in the epigenetic regulation of cell cycle, apoptosis, and differentiation. It has been reported that HDAC2 is upregulated in human hepatocellular carcinoma (HCC) and downregulated in the cervical cancer. Its downregulated expression in cervical cancer decreases the expression level of cyclin D1, cyclin E, and cdk2 proteins as well as enhances the expression of p21 protein. HDAC2 is associated with the human memory impairment. It has a negative influence on learning and memory by controlling the synaptic plasticity and modifications of neural circuits.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71018,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human, mouse packaging antibody small pack of 25 µL enhanced validation RNAi knockdown application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence IACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP conjugate unconjugated UniProt accession no. Q92769, shipped in wet ice storage temp. 20°C Gene Information human ... HDAC2(3066)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HDAC2 Antibody, clone 1E22 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1208-4X25UL ZRB1208-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1E22 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects HDAC2. It targets an epitope within 16 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 16 amino acids from the C-terminal region of human Histone Deacetylase 2 (HDAC2).ApplicationQuality Control Testing
Evaluated by Western Blotting in K562 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected HDAC2 in K562 cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected HDAC2 in HeLa, COS7, and NIH3T3 cell lysates.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected HDAC2 in human testis tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected HDAC2 in HeLa cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-HDAC2, clone 1E22 ZooMAb®, Cat. No. ZRB1208, is a rabbit recombinant monoclonal antibody that specifically targets HDAC2 and is tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Histone deacetylase 2 (UniProt: also known as EC:3.5.1.98, HDAC2, HD2) is encoded by the HDAC2 gene (Gene ID: 3066) in human. Histone deacetylases (HDACs) are chromatin-remodeling factors that deacetylate histones and act as transcriptional repressors or silencers of genes. They regulate histone acetylation by catalyzing the removal of acetyl groups on the amino terminal lysine residues of the core nucleosomal histones. Each cell is reported to have several different types of HDACs. HDAC2 belongs to class I of HDACs and is widely expressed and is primarily located in the nucleus. It is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. It forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. It also interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. HDAC2 is also reported to be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1E22, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt ~ 55.36 kDa, observed mol wt ~ 55 kDa species reactivity mouse, monkey, human species reactivity (predicted by homology) bovine packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HDAC8 antibody produced in rabbit
Human Protein Atlas Number: HPA048560 Human Protein Atlas characterization data
Кат. номер HPA048560-100UL HPA048560-25UL General descriptionHDAC8 (histone deacetylase 8) is a class I enzyme, that has 377 residue and it lies between class I and class II HDACs. It is located on X chromosome. It consists of a single α/β domain, in which eight parallely stranded β sheets are sandwiched between 13 α helices.Immunogenhistone deacetylase 8 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
HDAC8 (histone deacetylase 8), with the help of PKA (cyclic AMP dependent protein kinase A), plays a major role in confirming the acetylation state of histones. It may also play an important role in acute myeloid leukemia (AML). Suppression of HDAC8 by RNA interference stops the growth of lung, colon, and cervical cancer cell lines.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74388,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
orthogonal RNAseqapplication(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence VLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEF conjugate unconjugated UniProt accession no. Q9BY41, shipped in wet ice storage temp. 20°C Gene Information human ... HDAC8(55869)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HDGF antibody produced in rabbit
Human Protein Atlas Number: HPA048728 Human Protein Atlas characterization data
Кат. номер HPA048728-100UL HPA048728-25UL Immunogenhepatoma-derived growth factorApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87517,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence PEGEEKEAATLEVERPLPMEVEKNSTPSEPGS conjugate unconjugated UniProt accession no. P51858, shipped in wet ice storage temp. 20°C Gene Information human ... HDGF(3068)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HDGFL1 antibody produced in rabbit
Human Protein Atlas Number: HPA045679 Human Protein Atlas characterization data
Кат. номер HPA045679-100UL HPA045679-25UL Immunogenhepatoma derived growth factor-like 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83654,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunohistochemistry: 1:500-1:1000 immunogen sequence ELREEEVADEEASQEWHAEAPGGGDRDS conjugate unconjugated UniProt accession no. Q5TGJ6, shipped in wet ice storage temp. 20°C Gene Information human ... HDGFL1(154150)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HDHD3 antibody produced in rabbit
Human Protein Atlas Number: HPA024158 Human Protein Atlas characterization data
Кат. номер HPA024158-100UL HPA024158-25UL ImmunogenHaloacid dehalogenase-like hydrolase domain-containing protein 3 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75215,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
independentapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence LQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGW conjugate unconjugated UniProt accession no. Q9BSH5, shipped in wet ice storage temp. 20°C Gene Information human ... HDHD3(81932)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HECW2 antibody produced in rabbit
Human Protein Atlas Number: HPA034609 Human Protein Atlas characterization data
Кат. номер HPA034609-100UL HPA034609-25UL ImmunogenHECT, C2 and WW domain containing E3 ubiquitin protein ligase 2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79088,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence TATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPSSLEEEGGLIMFSRASRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLP conjugate unconjugated UniProt accession no. Q9P2P5, shipped in wet ice storage temp. 20°C Gene Information human ... HECW2(57520)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Helicase MOV-10 Antibody, clone 3B8 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1112-4X25UL ZRB1112-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 3B8 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Helicase MOV-10. It targets an epitope within 20 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 20 amino acids from the C-terminal region of human Helicase MOV-10.ApplicationWestern Blotting Analysis: A 1:1,000 dilution from a representative lot detected Helicase MOV-10 in HepG2 cell lysate.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Helicase MOV-10 in HepG2 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:10 dilution from a representative lot detected Helicase MOV-10 in human pancreas tissue sections.
Affinity Binding Assay:: A representative lot of this antibody bound Helicase MOV-10 peptide with a KD of 2.4 x 10-7 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Helicase MOV-10, clone 3B8 ZooMAb, Cat. No. ZRB1112, is a recombinant Rabbit monoclonal antibody that specifically targets Helicase MOV-10 and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry, and Western Blott
Target description
Helicase MOV-10 (UniProt: EC:3.6.4.13; also known as Armitage homolog, Moloney leukemia virus 10 protein) is encoded by the MOV10 (also known as KIAA1631) gene (Gene ID: 4343) in human. MOV-10 is an evolutionarily conserved member of the UPF1p family of SF-1 ATP-dependent RNA helicases that serves as a putative 5′ to 3′ RNA helicase and contributes to UPF1 mRNA target degradation by translocation along 3′ UTRs. It is shown to inhibit retrovirus replication and overexpression of MOV-10 is shown to severely impair infectivity of HIV-1 and other lentiviruses. It is required for microRNA (miRNA)-mediated gene silencing by the RNA-induced silencing complex (RISC). MOV-10 is also shown to be interferon-inducible RNA helicase and can exhibit antiviral activity independent of its helicase function, against several positive- and negative-strand RNA viruses by enhancing type -I interferon induction. MOV-10 is reported to severely restrict human LINE1 (L1), Alu, and SVA retrotransposons. It associates with the L1 ribonucleoprotein particle, along with other RNA helicases including DDX5, DHX9, DDX17, DDX21, and DDX39A. MOV-10 is co-enriched in cytoplasmic foci along with TUT4. In developing neurons, it is shown to localize both in nucleus and cytoplasm, however, in adults it is found only in the cytoplasmic. It is also required for embryonic viability and for normal central nervous system development and function. It is reported to play two critical roles in early brain development: suppresses retroelements in the nucleus by directly inhibiting cDNA synthesis and regulates cytoskeletal mRNAs to influence neurite outgrowth. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Goodier, JL., et al. (2012). PLoS Genet 8(10); e1002941; Cuevas RA., et al. (2016). J. Immunol. 196(9); 3877-3886).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source rabbit recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 3B8, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 113.67 kDa, observed mol wt ~114 kDa species reactivity human species reactivity (predicted by homology) bovine packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, immunocytochemistry: suitable, immunohistochemistry: suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HELLS antibody produced in rabbit
Human Protein Atlas Number: HPA063242 Human Protein Atlas characterization data
Кат. номер HPA063242-100UL HPA063242-25UL Immunogenhelicase, lymphoid-specificApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88023,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV conjugate unconjugated UniProt accession no. Q9NRZ9, shipped in wet ice storage temp. 20°C Gene Information human ... HELLS(3070)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HELT antibody produced in rabbit HPA036189-100UL
Human Protein Atlas Number: HPA036189 Human Protein Atlas characterization data Immunogenhelt bHLH transcription factorApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87163,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQL conjugate unconjugated UniProt accession no. A6NFD8, shipped in wet ice storage temp. 20°C Gene Information human ... HELT(391723)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HEMGN antibody produced in rabbit
Human Protein Atlas Number: HPA019572 Human Protein Atlas characterization data
Кат. номер HPA019572-100UL HPA019572-25UL General descriptionHEMGN (hemogen) is a hematopoietic-specific nuclear protein expressed in hematopoietic tissues. Specifically, it is expressed in the human hematopoietic tissues and cells such as adult bone marrow, CD34+ progenitor cells and leukemia cell line K562. It is located to chromosome 9q22.ImmunogenHemogen recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
HEMGN (hemogen) is mainly involved in the regulation of hematopoietic cell differentiation, proliferation, and apoptosis. It plays an important role in transcriptional regulation. It directly binds to the transcriptional regulators to control the apoptotic gene expression. It also plays an important role in the hematopoietic regulation. Promoter region of HEMGN directly binds to the homeobox transcription factor HOXB4 and promotes expansion of hematopoietic stem cells and hematopoietic progenitor cells. It has been reported that overexpression of HEMGN in cell lines restricts the expression for apoptosis and differentiation. Study proposes that HEMGN may play a regulatory role in acute myeloid leukemia (AML) and can be a new therapeutic target for the treatment of AML.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74491,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunohistochemistry: 1:200- 1:500 immunogen sequence PPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQ conjugate unconjugated UniProt accession no. Q9BXL5, shipped in wet ice storage temp. 20°C Gene Information human ... HEMGN(55363)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HENMT1 antibody produced in rabbit
Human Protein Atlas Number: HPA028464 Human Protein Atlas characterization data
Кат. номер HPA028464-100UL HPA028464-25UL ImmunogenUPF0486 protein C1orf59 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76996,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:50-1:200 immunogen sequence MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... C1orf59(113802)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-HERPUD2 antibody produced in rabbit
Human Protein Atlas Number: HPA015630 Human Protein Atlas characterization data
Кат. номер HPA015630-100UL HPA015630-25UL ImmunogenHomocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71872,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence VMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAHQYYMQYQAAVSAQATSNVNPTQPTTSQPLNLAHVPGEEPPPAPNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSR conjugate unconjugated UniProt accession no. Q9BSE4, shipped in wet ice storage temp. 20°C Gene Information human ... HERPUD2(64224)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HESX1 antibody produced in rabbit
Human Protein Atlas Number: HPA024187 Human Protein Atlas characterization data
Кат. номер HPA024187-100UL HPA024187-25UL ImmunogenHomeobox expressed in ES cells 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70961,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50-1:200 immunogen sequence QLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPG conjugate unconjugated UniProt accession no. Q9UBX0, shipped in wet ice storage temp. 20°C Gene Information human ... HESX1(8820)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HEXA antibody produced in rabbit
Human Protein Atlas Number: HPA054583 Human Protein Atlas characterization data
Кат. номер HPA054583-100UL HPA054583-25UL Immunogenhexosaminidase A (alpha polypeptide) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST73327,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunohistochemistry: 1:20-1:50","western blot: 0.04-0.4 µg/mL immunogen sequence LESFYIQTLLDIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYVVEPLAFE conjugate unconjugated UniProt accession no. P06865, shipped in wet ice storage temp. 20°C Gene Information human ... HEXA(3073)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HEXB antibody produced in rabbit
Human Protein Atlas Number: HPA055409 Human Protein Atlas characterization data
Кат. номер HPA055409-100UL HPA055409-25UL Immunogenhexosaminidase B (beta polypeptide) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85033,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence PSVSAKPGPALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYI conjugate unconjugated UniProt accession no. P07686, shipped in wet ice storage temp. 20°C Gene Information human ... HEXB(3074)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HEXDC antibody produced in rabbit
Human Protein Atlas Number: HPA023379 Human Protein Atlas characterization data
Кат. номер HPA023379-100UL HPA023379-25UL General descriptionThe gene HEXDC (hexosaminidase D) encodes a protein that is mainly expressed within human arthritic joints. It has been detected in rheumatoid arthritis and osteoarthritis synovial fibroblasts. The gene is mapped to human chromosome 17q25.3. The protein shows nucleocytoplasmic localization and is a member of glycosyl hydrolase family 20.ImmunogenHexosaminidase domain-containing protein recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
The gene HEXDC (hexosaminidase D) encodes a protein with N-acetyl--D-glucosaminidase activity in synovial fluid samples, synovial membranes, synovial fibroblast cell strains and synovial fibroblast-derived extracellular vesicles of rheumatoid arthritis and osteoarthritis patients. Its expression is found to be suppressed by TGF (transforming growth factor ). It is responsible for increased hexosaminidase activities in rheumatoid arthritis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75793,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence ASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQRYDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVEN conjugate unconjugated UniProt accession no. Q8WVB3, shipped in wet ice storage temp. 20°C Gene Information human ... HEXDC(284004)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HEXIM1 antibody produced in rabbit
Human Protein Atlas Number: HPA008926 Human Protein Atlas characterization data
Кат. номер HPA008926-100UL HPA008926-25UL General descriptionHEXIM1 (hexamethylene bis-acetamide inducible 1) functions as a homdimer and was first recognized in hexamethylene bisacetamide (HMBA) treated vascular smooth muscle cells. It is primarily known as the inhibitor of positive transcription elongation factor b (P-TEFb). This gene is localized to human chromosome 17q21.31.Immunogenhexamethylene bis-acetamide inducible 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
HEXIM1 (hexamethylene bis-acetamide inducible 1) is a tight regulator of the activity of positive transcription elongation factor b (P-TEFb). This protein interacts with the small P-TEFb complex, which then facilitates the formation of the large, inactive P-TEFb complex. Its interaction with P-TEFb is also responsible for the induction of differentiation of human pluripotent stem cells. Through regulation of P-TEFb, HEXIM1 controls the expression of cyclin D1 in mammary epithelial cells in a 17β-estradiol/estrogen receptor-α-dependent manner. Hexamethylene bisacetamide (HMBA) functions as an antagonist of HEXIM1 and leads to its dissociation from P-TEFb, thus promoting the transcription of HIV (human immunodeficiency virus).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71012,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence AKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERA conjugate unconjugated UniProt accession no. O94992, shipped in wet ice storage temp. 20°C Gene Information human ... HEXIM1(10614)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HEXIM2 antibody produced in rabbit
Human Protein Atlas Number: HPA028455 Human Protein Atlas characterization data
Кат. номер HPA028455-100UL HPA028455-25UL Immunogenhexamthylene bis-acetamide inducible 2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75786,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence YNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQ conjugate unconjugated UniProt accession no. Q96MH2, shipped in wet ice storage temp. 20°C Gene Information human ... HEXIM2(124790)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HEY1 antibody produced in rabbit
Human Protein Atlas Number: HPA055599 Human Protein Atlas characterization data
Кат. номер HPA055599-100UL HPA055599-25UL Immunogenhairy/enhancer-of-split related with YRPW motif 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78558,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunohistochemistry: 1:50-1:200","western blot: 0.04-0.4 µg/mL immunogen sequence HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG conjugate unconjugated UniProt accession no. Q9Y5J3, shipped in wet ice storage temp. 20°C Gene Information human ... HEY1(23462)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HFE antibody produced in rabbit
Human Protein Atlas Number: HPA017276 Human Protein Atlas characterization data
Кат. номер HPA017276-100UL HPA017276-25UL ImmunogenHereditary hemochromatosis protein precursor recombinant protein epitope signature tag (PrEST)ApplicationAnti-HFE antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71622,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence YLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPS conjugate unconjugated UniProt accession no. Q30201, shipped in wet ice storage temp. 20°C Gene Information human ... HFE(3077)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HGD antibody produced in rabbit HPA052359-100UL
Human Protein Atlas Number: HPA052359 Human Protein Atlas characterization data Immunogenhomogentisate 1,2-dioxygenaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88330,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation orthogonal RNAseq
independentapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 isotype IgG immunogen sequence AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQ conjugate unconjugated UniProt accession no. Q93099, shipped in wet ice storage temp. 20°C Gene Information human ... HGD(3081)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HGFAC antibody produced in rabbit
Human Protein Atlas Number: HPA058279 Human Protein Atlas characterization data
Кат. номер HPA058279-100UL HPA058279-25UL ImmunogenHGF activatorApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85381,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence DERPWCYVVKDSALSWEYCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIG conjugate unconjugated UniProt accession no. Q04756, shipped in wet ice storage temp. 20°C Gene Information human ... HGFAC(3083)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HGS antibody produced in rabbit
MDL number: MFCD04040366 Human Protein Atlas Number: HPA004872 Human Protein Atlas characterization data
Кат. номер HPA004872-100UL HPA004872-25UL General descriptionHGS (hepatocyte growth factor-regulated tyrosine kinase substrate) is a tyrosine-phosphorylated protein with a molecular mass of 115kDa. It is ubiquitously expressed and localized to the cytoplasmic face of early endosomes and multi-vesicular bodies. It is composed of VHS domain at the N-terminal end, a FYVE domain, two coiled-coil domains, proline and proline/glutamine-rich domains.ImmunogenHepatocyte growth factor-regulated tyrosine kinase substrate recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
HGS (hepatocyte growth factor-regulated tyrosine kinase substrate) is involved in the endocytic protein trafficking, signal transduction and inhibition of JAK/STAT signaling. It plays an essential role in the ventral folding morphogenesis since it has binding ability to various growth factors and cytokines through receptors. Overexpression of HGS causes the clustering of endosomes. It performs in the cytoskeletal regulation in association with the schwannomin, an actin-binding protein. It has also been suggested that HGS may negatively regulate the trafficking of EGF receptors to lysosomes.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86877,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence LAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDS conjugate unconjugated UniProt accession no. O14964, shipped in wet ice storage temp. 20°C Gene Information human ... HGS(9146)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HHATL antibody produced in rabbit
Human Protein Atlas Number: HPA018174 Human Protein Atlas characterization data
Кат. номер HPA018174-100UL HPA018174-25UL General descriptionThe gene HHATL (hedgehog acyltransferase-like protein) is mapped to human chromosome 3p22. HHATL is strongly expressed in heart and skeleton muscle. The protein is localized in the cytoplasm.ImmunogenProtein-cysteine N-palmitoyltransferase HHAT-like protein recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Hedgehog acyltransferase-like protein (HHATL) is down-regulated in skin squamous cell carcinoma and nasopharyngeal carcinoma. The gene functions as a potential tumor suppressor of nasopharyngeal carcinoma. High expression of HHATL reduces the proliferation, invasion and tumorgenicity in nude mice. HHTL is essential for postnatal skeletal muscle maturation in mice model. HHTL-knockout mice have swelled sarcoplasmic reticulum and presence of enormous vacuoles. Additionally, the unfolded protein response is severely activated in the knockout mice.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72713,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence ASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQ conjugate unconjugated UniProt accession no. Q9HCP6, shipped in wet ice storage temp. 20°C Gene Information human ... HHATL(57467)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HHIPL2 antibody produced in rabbit
Human Protein Atlas Number: HPA059673 Human Protein Atlas characterization data
Кат. номер HPA059673-100UL HPA059673-25UL ImmunogenHHIP-like 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88267,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:500- 1:1000 isotype IgG immunogen sequence LCSDYCSAFHSNCHSAISLLTNDRGLQESHGRDGTRFCHLLDLPDKDYCFPNVLRNDYLNRHLGMVAQDPQGC conjugate unconjugated UniProt accession no. Q6UWX4, shipped in wet ice storage temp. 20°C Gene Information human ... HHIPL2(79802)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HHLA2 antibody produced in rabbit
Human Protein Atlas Number: HPA055478 Human Protein Atlas characterization data
Кат. номер HPA055478-100UL HPA055478-25UL ImmunogenHERV-H LTR-associating 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88691,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200-1:500","western blot: 0.04-0.4 µg/mL isotype IgG immunogen sequence IFPLAFFTYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASL conjugate unconjugated UniProt accession no. Q9UM44, shipped in wet ice storage temp. 20°C Gene Information human ... HHLA2(11148)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HIBADH antibody produced in rabbit HPA021002-100UL
Human Protein Atlas Number: HPA021002 Human Protein Atlas characterization data General descriptionThe gene HIBADH (3-hydroxyisobutyrate dehydrogenase, mitochondrial) is mapped to human chromosome 7p15.2-p14.3. HIBADH transcripts are present in the cerebellum, heart, skeletal muscle, uterus, placenta and testis. The protein is expressed in the placenta, testis and spermatozoa. HIBADH mainly localizes in the mitochondria.Immunogen3-hydroxyisobutyrate dehydrogenase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)ApplicationAnti-HIBADH antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
HIBADH (3-hydroxyisobutyrate dehydrogenase, mitochondrial) is responsible for amino-acids metabolism in the gluconeogenesis pathway, and thus generates glucose. The identified substrates of HIBADH are 3-hydroxy-2-methylpropanoate and NAD+ (nicotinamide adenine dinucleotide). It is involved in valine, leucine and isoleucine degradation. HIBADH is suggested to participate in the mitochondrial function of spermatozoa, and thereby regulates sperm motility.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74906,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation independent application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence NPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLR conjugate unconjugated UniProt accession no. P31937, shipped in wet ice storage temp. 20°C Gene Information human ... HIBADH(11112)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HIBCH antibody produced in rabbit
Human Protein Atlas Number: HPA036541 Human Protein Atlas characterization data
Кат. номер HPA036541-100UL HPA036541-25UL Immunogen3-hydroxyisobutyryl-CoA hydrolaseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79242,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseq
RNAi knockdownapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence GSSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLNNHFKSLGSSDL conjugate unconjugated UniProt accession no. Q6NVY1, shipped in wet ice storage temp. 20°C Gene Information human ... HIBCH(26275)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HID1 antibody produced in rabbit
Human Protein Atlas Number: HPA023095 Human Protein Atlas characterization data
Кат. номер HPA023095-100UL HPA023095-25UL General descriptionThe gene HID1 (HID1 domain-containing) is mapped to human chromosome 17q25. It is a peripheral membrane protein, and moves between the Golgi apparatus and cytosol.ImmunogenUPF0663 transmembrane protein C17orf28 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Absence of HID1 (HID1 domain-containing) is associated with cancer development in various tissues. It might be linked with intracellular trafficking.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75777,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:20-1:50 immunogen sequence RPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAM conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... C17orf28(283987)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HIF1AN antibody produced in rabbit
Human Protein Atlas Number: HPA065302 Human Protein Atlas characterization data
Кат. номер HPA065302-100UL HPA065302-25UL Immunogenhypoxia inducible factor 1, alpha subunit inhibitorApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88133,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:500- 1:1000 immunogen sequence YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI conjugate unconjugated UniProt accession no. Q9NWT6, shipped in wet ice storage temp. 20°C Gene Information human ... HIF1AN(55662)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HINT2 antibody produced in rabbit
Human Protein Atlas Number: HPA059109 Human Protein Atlas characterization data
Кат. номер HPA059109-100UL HPA059109-25UL Immunogenhistidine triad nucleotide binding protein 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST89872,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence GVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQ conjugate unconjugated UniProt accession no. Q9BX68, shipped in wet ice storage temp. 20°C Gene Information human ... HINT2(84681)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HIP1 antibody produced in rabbit
MDL number: MFCD04118469 Human Protein Atlas Number: HPA013606 Human Protein Atlas characterization data
Кат. номер HPA013606-100UL HPA013606-25UL ImmunogenHuntingtin-interacting protein 1 recombinant protein epitope signature tag (PrEST)ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Biochem/physiol Actions
The HIP1 (huntingtin interacting protein 1) gene encodes a membrane-associated protein that binds to clathrin and adaptor protein and plays a role in clathrin-mediated endocytosis. It is found to interact with membrane-associated huntingtin in the brain and loss of this interaction may cause defects in membrane-cytoskeletal integrity in the brain and may be associated with Huntington disease.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72610,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity mouse, rat, human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence NFLRASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQRED conjugate unconjugated UniProt accession no. O00291, shipped in wet ice storage temp. 20°C Gene Information human ... HIP1(3092)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HIP14 antibody produced in rabbit
MDL number: MFCD09265361 NACRES: NA.41
Кат. номер H7414-25UL H7414-200UL General descriptionHuntingtin interacting protein 14 (HIP14) is a palmitoyl transferase (PAT) neuronal type, localizes to the Golgi, and to vesicles in the cytoplasm. HIP14 mRNA is predominantly expressed in the brain.Immunogensynthetic peptide corresponding to amino acids 614-632 located at the C-terminus of human HIP14. This sequence is identical in mouse, rat, dog, and bovine HIP14.ApplicationAnti-HIP14 antibody produced in rabbit has been used in quantitative immunoblotting, immunohistochemistry.
Biochem/physiol Actions
The interaction of huntingtin interacting protein 14 (HIP14) with huntingtin protein (htt) is inversely correlated to the polyQ length.. HIP14 along with htt is localized in striatum, medium spiny projection neurons. It is also associated neurons associated with Huntington disease (HD). HIP14 under expression in neurons reduces the clustering of postsynaptic density protein 95 (PSD-95) and glutamic acid decarboxylase 65-kilodalton isoform (GAD65). It has been suggested that HIP14 has a role in palmitoylation and in regulating the intracellular trafficking of multiple neuronal proteins. Decreased interaction between mutant htt and HIP14 could contribute to neuronal dysfunction in HD by perturbing normal intracellular transport pathways in neurons.
Target description
HIP14 (also known as zinc finger, DHHC domain containing protein 17 (ZDHHC17), huntingtin interacting protein H (HYPH), huntingtin interacting protein 3 (HIP3), HSPC294 and KIAA0946) is a novel htt interacting protein.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, and 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~75 kDa (mouse)","antigen ~78 kDa (human) species reactivity bovine, human, mouse, canine, rat enhanced validation recombinant expression application(s) western blot: 0.5-1 µg/mL using extracts of HEK-293T cells expressing human HIP14 and mouse brain extracts (P2 membrane fraction) conjugate unconjugated UniProt accession no. Q8IUH5, shipped in dry ice storage temp. 20°C Gene Information human ... ZDHHC17(23390)
mouse ... Zdhhc17(320150)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 3 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HIP1R antibody produced in rabbit
Human Protein Atlas Number: HPA038135 Human Protein Atlas characterization data
Кат. номер HPA038135-100UL HPA038135-25UL Immunogenhuntingtin interacting protein 1 relatedApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87274,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500 immunogen sequence VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR conjugate unconjugated UniProt accession no. O75146, shipped in wet ice storage temp. 20°C Gene Information human ... HIP1R(9026)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HIRA antibody produced in rabbit
Human Protein Atlas Number: HPA050714 Human Protein Atlas characterization data
Кат. номер HPA050714-100UL HPA050714-25UL Immunogenhistone cell cycle regulatorApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87569,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence LKLPIPSPQRAFTLQVSSDPSMYIEVENEVTVVGGVKLSRLKCNREGKEWETVLTSRILTAAGSCDVVCVACEKRMLSVFSTCGRRLLSPILLPSPISTLHC conjugate unconjugated UniProt accession no. P54198, shipped in wet ice storage temp. 20°C Gene Information human ... HIRA(7290)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-HIST1H1T antibody produced in rabbit
Human Protein Atlas Number: HPA065718 Human Protein Atlas characterization data
Кат. номер HPA065718-100UL HPA065718-25UL Immunogenhistone cluster 1, H1tApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST92590,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent application(s) immunohistochemistry: 1:5000- 1:10000 immunogen sequence RATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSKK conjugate unconjugated UniProt accession no. P22492, shipped in wet ice storage temp. 20°C Gene Information human ... HIST1H1T(3010)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Histone Deacetylase 4 (HDAC4) (DM-15) antibody produced in rabbit H9536-200UL
MDL number: MFCD03791600 NACRES: NA.41 General descriptionHistone deacetylases (HDACs) are competing enzymes, belonging to histone deacetylase family. There are two classes of HDACs with six to seven different types of HDACs proteins. HDAC1,HDAC2 and HDAC3 belong to Class I HDACs and HDAC4, HDAC6, and HDAC7 belong to Class II HDACs. Class I HDACs consists of a single deacetylase domain at the N-termini and diversified C-terminal regions, while Class II contains a deacetylase domain at C-terminal position.
Mammalian histone deacetylases (HDACs) are classified into three classes according to sequence homology. HDAC1, HDAC2, HDAC3 and HDAC8 belong to class I HDACs and HDAC4, HDAC6, and HDAC7 belong to class II HDACs. Class III consists of the yeast sirtuins (sir2-like protein). Class I HDACs are ubiquitously expressed. Whereas, most of the class II HDACs show tissue-specific expression. The antibody is affinity-purified using the immunizing peptide immobilized on agarose.
Specificity
Anti-Histone Deacetylase 4 (HDAC4), recognizes human, mouse and rat HDAC4.ImmunogenSynthetic peptide corresponding to amino acid residues of human HDAC4 with C-terminal added lysine conjugated to KLH.ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below:- Western Blotting
- Immnofluorescence
- Immunoprecipitation
Biochem/physiol Actions
Histone deacetylase 4 (HDAC4) contains import and export nuclear signal that aids in nucleocytoplasmic shuttling. It has physical and functional interactions with transcription factor myocyte enhancer factor-2 (Mef2) protein and 14-3-3. This interaction disturbs nucleocytoplasmic shuttling and then guides HDAC4 to the cytoplasm and the nucleus, respectively. In addition, HDAC4 with HDAC5 and HDAC7 represses transcription by binding to the nuclear receptor co-repressors silencing mediator of retinoic acid and thyroid hormone receptors (SMRT) and nuclear receptor co-repressor (NCOR).
Studies show that HDAC4 contains a composed import and export nuclear signal that aids in nucleocytoplasmic shuttling. It has physical and functional interactions with transcription factor MEF2C and 14-3-3. This interaction results in the shuttling and it guides HDAC4 to the cytoplasm and the nucleus.The C-terminal domain of HDAC4 shows innate histone deacetylase activity. It is seen that MEF2C combines with HDAC4 at the N-terminal domain and downmodulate c-jun promoter activity.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% bovine serum albumin and 15 mM sodium azide.
Storage and Stability
For continuous use, store at 2-8°C for up to one month. For prolonged storage, freeze in working aliquots at -20°C. Repeated freezing and thawing is not recommended. Storage in frost-free freezers is also not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~140 kDa species reactivity rat, mouse, human enhanced validation recombinant expression application(s) immunoprecipitation (IP): 10-20 µg using RIPA extract of HeLa nuclei","indirect immunofluorescence: 1:250 using HEK 293T cells expressing recombinant mouse HDAC4","microarray: suitable","western blot: 1:1,000 using whole extracts of mouse NIH3T3 cells","western blot: 1:500 using whole extracts of rat brain conjugate unconjugated UniProt accession no. P56524, shipped in dry ice storage temp. 20°C Gene Information human ... HDAC4(9759)
mouse ... Hdac4(208727)
rat ... Hdac4(363287)
Safety InformationRIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Histone Deacetylase 8 (HDAC8) antibody produced in rabbit H8038-200UL
MDL number: MFCD04975119 General descriptionHistone deacetylases (HDACs) are competing enzymes, belonging to histone deacetylase family. There are two classes of HDACs with six to seven different types of HDACs proteins. HDAC1,HDAC2, HDAC3, and HDAC8 belong to Class I HDACs and HDAC4, HDAC6, HDAC7, HDAC9, and HDAC10 belong to Class II HDACs. Class I HDACs consists of a single deacetylase domain at the N-termini and diversified C-terminal regions, while Class II contains a deacetylase domain at C-terminal position. Studies show that HDAC8 is a sex-linked gene located on the chromosome at position Xq21.2 - q21.3. HDAC8 gene has a molecular weight of 43kDa and it encodes a 377 amino acid protein. It is present within the nucleas. HDAC8 mRNA is seen in heart, lung, kidney, and pancreas.
The antibody is affinity-purified using the immunizing peptide immobilized on agarose.Immunogensynthetic peptide corresponding to amino acid residues 352-370 of human HDAC8, conjugated to KLH. The corresponding sequence in mouse differs by one amino acid.ApplicationAnti-Histone Deacetylase 8 (HDAC8) antibody produced in rabbit has been used in western blotting, immunohistofluorescence and immunoblotting.
Biochem/physiol Actions
Histone deacetylation results in transcription repression leading to the formation of tight nucleosomal structure which prevents DNA accessing. {5} HDAC8 controls HDAC activity on H4 histone peptide substrates. HDAC8 is similar to the HDAC class I enzymes. In vitro expression and activity of HDAC8 was examined using FLAG tagged- HDAC8 and HDAC1. These were transfected into HeLa cells and Sf9 insect cells. After the immunoprecipitation of cell lysates the expression results were confirmend using Western blotting. Studies show that HDAC8 may play a role in role in transcriptional regulation and could possibly be regulated in a temporal or compartment-specific manner.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 1% bovine serum albumin and 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~43 kDa species reactivity human, mouse enhanced validation recombinant expression application(s) immunocytochemistry: 1-2 µg/mL using cultured 293T cells expressing recombinant human HDAC8","immunoprecipitation (IP): 1-2 µg using extract of 293T cells expressing recombinant human HDAC8","western blot: 2-4 µg/mL using whole extract of human colon adenocarcinoma SW620 cells and a chemiluminescent detection reagent conjugate unconjugated UniProt accession no. Q9BY41, shipped in dry ice storage temp. 20°C Gene Information human ... HDAC8(55869)
mouse ... Hdac8(70315)
Safety InformationRIDADR NONH for all modes of transport WGK Germany nwg Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Histone H2A.X Antibody, clone 1C22 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1663-4X25UL ZRB1663-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 1C22 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Histone H2AX. It targets an epitope within 15 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 15 amino acids from the C-terminal region of human Histone H2AX.ApplicationAnti-Histone H2A.X, clone 1C22 ZooMAb, Cat. No. ZRB1663, is a recombinant Rabbit monoclonal antibody that targets Histone H2A.X and is tested for use in Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality Control Testing
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Histone H2A.X in MCF-7 cell lysate.Tested applicationsWestern Blotting Analysis: A 1:1,000 dilution from a representative lot detected Histone H2A.X in C6, Neuro-2A, and PC12 cell lysates.Immunocytochemistry Analysis: A 1:1,000 dilution from a representative lot detected Histone H2A.X in HeLa, A431, HepG2, NIH 3T3, AC16, and MCF-7 cells.Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected Histone H2A.X in human cerebral cortex tissue sections.Flow Cytometry Analysis: 1 µg from a representative lot detected Histone H2A.X in one million HeLa cells.Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Histone H2AX (UniProt: P16104; also known as H2a/x, Histone H2A.X) is encoded by the H2AX (also known as H2AFX) gene (gene ID: 3014) in human. Histones are highly conserved basic nuclear proteins that are responsible for the nucleosome structure of chromatin in eukaryotes. They play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which DNA is wrapped in repeating units, called nucleosomes, which limits DNA accessibility to the cellular machineries that require DNA as a template. The histone H2A.X is a variant member of the H2A family of histones that is distinguished from other H2A histones by a unique carboxy-terminal sequence. This unique sequence is highly conserved throughout eukaryotic evolution and is rapidly phosphorylated by ATM or ATR at serine 139 in mammals in response to DNA double-strand breaks. H2A.X phosphorylation is important in the formation of a stable repair complex at the site of DNA damage. Phosphorylation of H2A.X is important in the formation of a stable repair complex at the site of DNA damage. This phosphorylation is a very rapid response to DNA damage, occurring within as little as one minute after exposure to ionizing radiation. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody clone recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 15.15 kDa, observed mol wt ~ 16 kDa species reactivity human, mouse, rat packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) flow cytometry: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Histone H2B Antibody, clone 4O11 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1624-4X25UL ZRB1624-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 4O11 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Histone H2B. It targets an epitope within 9 amino acids from the C-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 9 amino acids from the C-terminal region of human Histone H2B.ApplicationAnti-Histone H2B, clone 4O11 ZooMAb, Cat. No. ZRB1624, is a recombinant Rabbit monoclonal antibody that specifically targets Histone H2B and is tested for use in Affinity Binding Assay, Immunohistochemistry (Paraffin), and Western Blotting.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected Histone H2B in K562, Cos-7, NIH3T3, and HeLa cell acid extract.
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected Histone H2B in human cerebral cortex tissue sections.
Affinity Binding Assay: A representative lot of this antibody bound Histone H2B peptide with a KD of 3.4 x 10-6 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Histone H2B (UniProt: Q8N257; also known as H2B, H2B type 12) is encoded by the HIST3H2BB gene (Gene ID: 128312) in human. Histones are basic nuclear proteins that are responsible for the nucleosome structure of chromatin in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which DNA is wrapped in repeating units, called nucleosomes, which limits DNA accessibility to the cellular machineries, which require DNA as a template. Histones play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone H2B is one of the main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N terminal tail, H2B is involved with the structure of the nucleosomes of the ′beads on a string′ structure. Histone H2B can be monoubiquitinated on Lysine 35 by the MSL1/MSL2 dimer and this ubiquitination is reported to be essential for histone H3 lysine 4 (H3K4me) and lysine 79 (H3K79me) methylation and transcription activation at specific gene loci, such as HOXA9 and MEIS1 loci. Similarly, monoubiquitination at lysine 121(H2BK120Ub) by the RNF20/40 complex gives a specific tag for epigenetic transcriptional activation and is a prerequisite for histone H3 lysine 4 and lysine 79 methylation. Histone H2B undergoes phosphorylation at serine 37 by AMPK in response to stress and promotes transcription. During apoptosis and DNA double strand breaks it is phosphorylated on serine 15 by STK4/MST1 that facilitates apoptotic chromatin condensation. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 4O11, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 13.91 kDa, observed mol wt ~16 kDa species reactivity rat, monkey, mouse, human packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-Histone H3.3 G34R Antibody, clone 2L10 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1438-4X25UL ZRB1438-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 2L10 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects human Histone H3.3 with G34R mutation.ImmunogenKLH-conjugated linear peptide corresponding to 8 amino acids from the N-terminal region of human Histone H3.3 with G34R mutation.ApplicationAnti-Histone H3.3 G34R, clone 2L10 ZooMAb, Cat. No. ZRB1438, is a recombinant Rabbit Monoclonal antibody that targets G34R mutated Histone H3.3 and is tested in Affinity Binding Assay, Immunocytochemistry, and Western Blotting.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected Histone H3.3 G34R in HEK 293T WT and G34R transfected cell lines.
Affinity Binding Assay: A representative lot of this antibody bound Histone H3.3 G34R peptide with a KD of 1.1 x 10-6 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Histone H3.3 (UniProt: P84243) is encoded by the H3F3A (also known as H3.3A, H3F3, PP781, H3F3B, H3.3B) gene (Gene ID: 3020) in human. It is a highly conserved variant form of Histone H3, which replaces conventional H3 in a wide range of nucleosomes in active genes. Histone H 3.3 constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. H3.3 is associated with actively expressed genes in both animals and plants. It is predominantly enriched near transcription end sites (TES) of genes and positively associated with transcription. Histone H3 contains a main globular domain and a long N-terminal tail and is involved with the structure of the nucleosomes of the beads on a string structure. The N-terminal tail of histone H3 protrudes from the globular nucleosome core and can undergo several different types of epigenetic modifications that influence cellular processes. These modifications include the covalent attachment of methyl or acetyl groups to lysine and arginine amino acids and the phosphorylation of serine or threonine. For example, acetylation on Lys10 (H3K9ac; initial methionine removed) impairs methylation at Arg9 (H3R8me2s) and acetylation on Lys19 (H3K18ac) and Lys24 (H3K24ac) favors methylation at Arg18 (H3R17me). Phosphorylation at Ser11 (H3S10ph) by Aurora kinase B is crucial for chromosome condensation and cell-cycle progression during mitosis and meiosis. Phosphorylation at Ser11 by RPS6KA4 and RPS6KA5 is important during interphase because it enables the transcription of genes following external stimulation, like mitogens, stress, growth factors or UV irradiation and result in the activation of genes, such as c-Fos and c-Jun. Mutations in Histone H3.3 have been implicated in a high proportion of malignant pediatric brain cancers. The mutant H3.3 histone disrupts epigenetic post-translational modifications near genes involved in cancer processes and in brain function. In tumor cells, H3.3K27M and H3.3G34R/V mutations are heterozygously expressed, with one allele of H3F3A being wildtype. K27M and G34R/V mutations are mutually exclusive in tumors and display distinct gene expression profiles and DNA methylation patterns. Almost all tumors bearing G34R/V mutations also exhibit mutations in ATRX/DAXX and display alternate lengthening of telomeres, which is a classical phenotype of cancerous cells. (Ref.: Yuen, BT., and Knoepfler PS (2013). Cancer cell 24(5); 567-74). This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
0.03 mg/mL after reconstitution at 25μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommended storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 15.33 kDa, observed mol wt ~16 kDa, observed mol wt ~19 kDa species reactivity human packaging pkg of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, immunocytochemistry: suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety Information
