Protein Biology
- Сортировать:
- Вид таблицей
-
Anti-LDL Receptor Antibody, clone 2N19, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1176-25UL ZRB1176-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 2N19 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects LDL receptor. It targets an epitope within 105 amino acids from the C-terminal region.ImmunogenHis-tagged recombinant fragment corresponding to 105 amino acids from the C-terminal region of human LDL receptor.ApplicationWestern Blotting Analysis: A 1:1,000 dilution from a representative lot detected LDL Receptor in RAW264.7 and HEPG2 cell lysates.
Immunohistochemistry (Paraffin) Analysis: A 1:100-1,000 dilution from a representative lot detected LDL Receptor in human liver and rat liver tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution of from a representative lot detected LDL Receptor in A431, HepG2, NIH 3T3 cells.
Flow Cytometry Analysis: 0.1 µg from a representative lot detected LDL Receptor in HepG2.
Note: Actual optimal working dilutions must be determined by the end user as specimens and experimental conditions may vary.
Anti-LDL Receptor, clone 2N19 ZooMAb , Cat. No. ZRB1176, is a highly specific rabbit recombinant monoclonal antibody that targets Low-Density Lipoprotein Receptor and has been tested for use in Flow Cytometry, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Target description
Low-density lipoprotein receptor (UniProt P01130; also known as LDL receptor) is encoded by the LDLR (also known as FH, FHC) gene (Gene ID: 3949) in human. LDL receptor is a single-pass type I membrane protein that is rapidly endocytosed upon ligand binding. It binds low density lipoprotein (LDL) and transports it into cells by endocytosis. LDL receptor recognizes the apoprotein B100 embedded in the outer phospholipid layer of cholesterol-rich LDL particles and mediates their removal by endocytosis via clathrin-coated pits. It also recognizes the ApoE protein found in chylomicron remnants and VLDL remnants (IDL). LDL receptor is synthesized with a signal peptide (aa 1-21), which is subsequently cleaved off to generate the mature form. The mature form of LDL receptor contains an extracellular domain (aa 22-788), a transmembrane domain (aa 789-810), and a cytoplasmic domain (aa 811-860). The extracellular region contains seven class A (aa 25-313) and six class B (aa 397-658) LDLR repeats and three EGF-like domains (aa 314-353, 354-393, 663-712). LDL-A repeats are known to mediate LDL binding, and repeats 2-7 are required for ApoB binding, while only repeat 5 is required for ApoE binding. The class B (LDL-B) repeats region adopts a beta-propeller conformation and is believed to be responsible for the pH-dependent release of LDL in the endosome. The cytoplasmic tail contains a signal sequence that is important for localizing the receptors to clathrin-coated pits and for triggering receptor-mediated endocytosis upon LDL binding. Mutations in LDLR gene are known to cause familial hypercholesterolemia (FH) leading to high levels of serum LDL and excess deposition of cholesterol in tissues leading to atherosclerosis and higher risk of premature coronary heart disease. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose. Normal appearance is a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 2N19, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 95.38 kDa, observed mol wt ~95 kDa species reactivity rat, human packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) flow cytometry: suitable, immunocytochemistry: suitable, immunohistochemistry: suitable, western blot: suitable (peptide) isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LDLRAD1 antibody produced in rabbit
Human Protein Atlas Number: HPA052489 Human Protein Atlas characterization data
Кат. номер HPA052489-100UL HPA052489-25UL Immunogenlow density lipoprotein receptor class A domain containing 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83628,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:1000-1:2500 immunogen sequence GAQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSLPHFLVAHCGDPASWI conjugate unconjugated UniProt accession no. Q5T700, shipped in wet ice storage temp. 20°C Gene Information human ... LDLRAD1(388633)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LDLRAD3 antibody produced in rabbit HPA038251-100UL
Human Protein Atlas Number: HPA038251 Human Protein Atlas characterization data Immunogenlow density lipoprotein receptor class A domain containing 3 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST79666,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation recombinant expression application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50","western blot: 0.04-0.4 µg/mL immunogen sequence LHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPA conjugate unconjugated UniProt accession no. Q86YD5, shipped in wet ice storage temp. 20°C Gene Information human ... LDLRAD3(143458)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LECT2 antibody produced in rabbit
Human Protein Atlas Number: HPA043883 Human Protein Atlas characterization data
Кат. номер HPA043883-100UL HPA043883-25UL Immunogenleukocyte cell-derived chemotaxin 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87422,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence NKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPT conjugate unconjugated UniProt accession no. O14960, shipped in wet ice storage temp. 20°C Gene Information human ... LECT2(3950)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LEF1 antibody produced in rabbit
MDL number: MFCD02687915 Human Protein Atlas Number: HPA002087 Human Protein Atlas characterization data
Кат. номер HPA002087-100UL HPA002087-25UL General descriptionThe lymphoid enhancer-binding factor (LEF-1) is a regulatory protein with high mobility group (HMG) domain.ImmunogenLymphoid enhancer-binding factor 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
LEF-1 (lymphoid enhancer-binding factor 1) acts as a nuclear transducer or downstream effector in canonical Wingless/Wnt signal transduction pathway. It participates in different biological processes, such as proliferation, differentiation and migration, as a transcriptional activator or repressor. During Wnt signaling, LEF-1 interacts as a dimer with the nucleus-imported β-catenin to activate transcription of target genes. It plays a major role in the formation of hair follicles by regulating cytokeratin expression.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST84768,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
recombinant expressionapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY conjugate unconjugated UniProt accession no. Q9UJU2, shipped in wet ice storage temp. 20°C Gene Information human ... LEF1(51176)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LELP1 antibody produced in rabbit
Human Protein Atlas Number: HPA070231 Human Protein Atlas characterization data
Кат. номер HPA070231-100UL HPA070231-25UL Immunogenlate cornified envelope-like proline-rich 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88656,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:1000- 1:2500 isotype IgG immunogen sequence DKSKSNDPKTEPKNCDPKCEQKCESKCQP conjugate unconjugated UniProt accession no. Q5T871, shipped in wet ice storage temp. 20°C Gene Information human ... LELP1(149018)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LENG1 antibody produced in rabbit
Human Protein Atlas Number: HPA043541 Human Protein Atlas characterization data
Кат. номер HPA043541-100UL HPA043541-25UL Immunogenleukocyte receptor cluster (LRC) member 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82573,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000","western blot: 0.04-0.4 µg/mL immunogen sequence PDEKIKSRLDPLREMQKHLGKKRQHGGDEGSRSRKEKEGSEKQRPKEPPSLDQLRAERLRREAA conjugate unconjugated UniProt accession no. Q96BZ8, shipped in wet ice storage temp. 20°C Gene Information human ... LENG1(79165)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LEO1 antibody produced in rabbit
Human Protein Atlas Number: HPA040741 Human Protein Atlas characterization data
Кат. номер HPA040741-100UL HPA040741-25UL ImmunogenLeo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST81588,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence SGQPSNKELFGDDSEDEGASHHSGSDNHSERSDNRSEASERSDHEDNDPSDVDQHSGSEAPNDDEDEGHRSDGGSHHSEAEGSEKAHSDDEKWGREDKSDQSDDEKIQNSD conjugate unconjugated UniProt accession no. Q8WVC0, shipped in wet ice storage temp. 20°C Gene Information human ... LEO1(123169)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LETM1 antibody produced in rabbit
Human Protein Atlas Number: HPA011029 Human Protein Atlas characterization data
Кат. номер HPA011029-100UL HPA011029-25UL General descriptionLETM1 (Leucine zipper-EF-hand containing transmembrane protein 1) is a mitochondrial inner membrane protein, and is homologous to yeast protein Mdm38p. It was originally recognized as one of the genes deleted in Wolf-Hirschhorn syndrome. It is a transmembrane protein, which has 14-3-3-like domain in its soluble region, two EF hand Ca2+-binding motifs and two coiled-coil domains. The C-terminal of this protein is hydrophilic and faces the matrix, whereas the N-terminal is hydrophobic and spans the membrane. It has a molecular weight of 83.4kDa. This gene is located on human chromosome 4p16.3.ImmunogenLETM1 and EF-hand domain-containing protein 1, mitochondrial Precursor (Leucine zipper-EF-hand-containing transmembrane protein 1)ApplicationAnti-LETM1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
LETM1 (Leucine zipper-EF-hand containing transmembrane protein 1) is responsible for maintaining the shape and volume of mitochondria. It plays a part in mitochondrial translation machinery and mitochondrial biogenesis. It regulates the buffering of mitochondria by controlling Ca2+/H+ antiporter, and also regulates K+/H+ ion exchange. Inactivation of this gene is associated with Wolf-Hirschhorn syndrome, where it leads to aberration in mitochondrial functionality. It is responsible for growth and motor delay, as well as seizures which characterize Wolf-Hirschhorn syndrome. It is up-regulated in various human cancers, and is involved in the tumorigenesis of head and neck squamous cell carcinoma (HNSCC). It also predicts poor prognosis in HNSCC. Up-regulation of this gene leads to suppressed mitochondrial biogenesis and ATP synthesis, leading to necrotic cell death.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72188,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence SKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLE conjugate unconjugated UniProt accession no. O95202, shipped in wet ice storage temp. 20°C Gene Information human ... LETM1(3954)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Leupaxin (N-terminal) antibody produced in rabbit
NACRES: NA.41
Кат. номер SAB4200010-25UL SAB4200010-200UL General descriptionLeupaxin gene is mapped to human chromosome 11q12.1. Leupaxin belongs to the paxillin protein family It is mainly expressed in macrophages, lymphoid tissues and hematopoietic cells. Leupaxin comprises two types of protein interaction domains, LIM domain and leucine−aspartate (LD) motifs. LIM domains mediate localization to focal contacts. LD motifs facilitates focal adhesion kinase (FAK) and vinculin binding, resulting in the localization of focal adhesion kinase (FAK) to focal adhesions. The C-terminal LIM domains in leupaxin share 70% amino acid identity with paxillin. The N-terminal region of leupaxin comprises three short stretches of 13 amino acids that share 70− 90% similarity with paxillin LD motifs.
Specificity
Anti-Leupaxin (N-terminal) specifically recognizes human leupaxin.ApplicationAnti-Leupaxin antibody produced in rabbit has been used in immunoblotting and proximity ligation assay.
Biochem/physiol Actions
Leupaxin in association with a second focal adhesion kinase (FAK) family member, PYK2, acts a cell type-specific signaling complex regulator in leukocytes. It acts as a tyrosine kinase substrate in lymphoid cells and thus, may function in and be regulated by tyrosine kinase activity. Leupaxin facilitates adhesion and invasion of prostate carcinoma cells. It can form a complex with PYK2 and PTP-PEST in various cells such as monocytes and osteoclasts and in prostate cancer cells. In osteoclasts, leupaxin acts as a key nucleating component of the osteoclast podosomal signaling complex in the adhesion zone.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze at –20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous solution mol wt antigen ~43 kDa species reactivity human enhanced validation recombinant expression application(s) western blot: 1-2 µg/mL using extracts of Raji cells conjugate unconjugated UniProt accession no. O60711, shipped in dry ice storage temp. 20°C Gene Information human ... LPXN(9404)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-Leupaxin antibody produced in rabbit
Кат. номер SAB4200009-25UL SAB4200009-200UL General descriptionLeupaxin is a LIM domain phosphotyrosine protein, encoded by the gene mapped to human chromosome 11q12.1. It is a member of paxillin protein family and is preferentially expressed in macrophages, lymphoid tissues and hematopoietic cells. Leupaxin contains two types of protein interaction domains, LIM and leucine−aspartate (LD) motifs that share homology with paxillin. LIM domains have been shown to mediate localization to focal contacts. LD motifs have been implicated in focal adhesion kinase (FAK) and vinculin binding, resulting in the localization of FAK to focal adhesions. The C-terminal LIM domains in leupaxin share 70% amino acid identity with paxillin. The N-terminal region of leupaxin contains three short stretches of 13 amino acids that share 70−90% similarity with paxillin LD motifs.
Specificity
Anti-Leupaxin specifically recognizes human leupaxin.ApplicationAnti-Leupaxin antibody produced in rabbit may be used in immunoblotting.
Biochem/physiol Actions
Leupaxin associates with a second FAK family member, PYK2 and regulates cell type-specific signaling complex in leukocytes. It also acts as a substrate for a tyrosine kinase in lymphoid cells and thus, may function in and be regulated by tyrosine kinase activity. It can form a complex with PYK2 and PTP-PEST in several cell types including monocytes and osteoclasts and in prostate cancer cells. In osteoclasts, leupaxin has been suggested to be a critical nucleating component of the osteoclast podosomal signaling complex in the adhesion zone. It is expressed in prostate cancer and is thought to play a role in adhesion and invasion of prostate carcinoma cells.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Storage and Stability
Store at –20 °C. For continuous use, the product may be stored at 2–8 °C for up to one month. For extended storage, freeze at –20 °C in working aliquots. Repeated freezing and thawing, or storage in “frost-free” freezers, is not recommended. If slight turbidity occurs upon prolonged storage, clarify the solution by centrifugation before use. Working dilutions should be discarded if not used within 12 hours.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution mol wt antigen ~43 kDa species reactivity human enhanced validation recombinant expression concentration ~1.0 mg/mL application(s) western blot: 1-2 µg/mL using extracts of Raji cells conjugate unconjugated UniProt accession no. O60711, shipped in dry ice storage temp. 20°C Gene Information human ... LPXN(9404)
mouse ... Lpxn(107321)
rat ... Lpxn(293783)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LEXM antibody produced in rabbit
Human Protein Atlas Number: HPA035889 Human Protein Atlas characterization data
Кат. номер HPA035889-100UL HPA035889-25UL Immunogenlymphocyte expansion moleculeApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76973,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:200-1:500 immunogen sequence SHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVSHIGPGTYSSKETCFSKKKLMKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFL conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... C1orf177(163747)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGALS1
Human Protein Atlas Number: HPA000687 Human Protein Atlas characterization data
Кат. номер HPA000687-25UL HPA000687-100UL ImmunogenRecombinant protein corresponding to lectin, galactoside-binding, soluble,1.
Sequence
LKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) western blot: 0.04-0.4 µg/mL conjugate unconjugated UniProt accession no. P09382, shipped in wet ice storage temp. 20°C Gene Information human ... LGALS1(3956)
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGALS1 antibody produced in rabbit
Human Protein Atlas Number: HPA000646 Human Protein Atlas characterization data
Кат. номер HPA000646-100UL HPA000646-25UL ImmunogenGalectin-1 recombinant protein epitope signature tag (PrEST)ApplicationAnti-LGALS1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Galectin-1 (also known as GBP, GAL1) is a protein encoded by the LGALS1 gene in humans. It is a member of a family of multifunctional lectins, plays key roles in diverse biological processes that includes cell signaling, immunomodulation, neuroprotection and angiogenesis. It modulates tumor progression by mediating cell-cell and cell-extracellular matrix interactions, as well as angiogenesis and tumor immune-escape. The gene is associated with nasopharyngeal carcinoma (NPC), also contributes to both tumorigenesis and cisplatin resistance in epithelial ovarian cancer (EOC). Gal-1 is considered as a potential therapeutic target for EOC.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST73441,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity rat, mouse, human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence EVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCV conjugate unconjugated UniProt accession no. P09382, shipped in wet ice storage temp. 20°C Gene Information human ... LGALS1(3956)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGALS2 antibody produced in rabbit
Human Protein Atlas Number: HPA003536 Human Protein Atlas characterization data
Кат. номер HPA003536-100UL HPA003536-25UL ImmunogenGalectin-2 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Galectin-2 is a protein encoded by the LGALS2 gene in humans. It is also known as HL14 and is structurally closely related to galectin-1, but has a distinct expression profile primarily confined to the gastrointestinal tract. It acts as a novel inhibitor of arteriogenesis. Modulation of this gene may constitute a new therapeutic strategy for the stimulation of arteriogenesis in patients with coronary artery disease (CAD).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST73548,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200- 1:500 immunogen sequence LEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKL conjugate unconjugated UniProt accession no. P05162, shipped in wet ice storage temp. 20°C Gene Information human ... LGALS2(3957)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGALS3 antibody produced in rabbit HPA003162-100UL
Human Protein Atlas Number: HPA003162 Human Protein Atlas characterization data General descriptionLGALS3 (lectin, galactoside-binding, soluble, 3) gene encodes a galactose-specific lectin called ′Galectin-3′ that belongs to the galectin family of carbohydrate binding proteins. It has a molar mass of approximately 30kDa and may be localized to the extracellular matrix, the cytoplasm and the nucleus. It has a proline- and glycine-rich NH(2)-terminal domain that is fused to a single C-terminal domain that binds to galactose-containing glycoconjugates.ImmunogenGalectin-3 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Galectin-3 functions in acute inflammation, chronic inflammation and tissue fibrogenesis and may serve as a potential therapeutic target in the treatment of various inflammatory diseases. It forms a complex with NG2 proteoglycan and alpha3beta1 integrin on the cell surface and promotes endothelial cell motility and morphogenesis during early stages of neovascularization. It associates with Bcl-2, an apoptosis repressor in the cytoplasm and exhibit anti-apoptotic activity. Gal-3 also serves as a pre-mRNA splicing factor by interacting with the U1 small nuclear ribonucleoprotein (snRNP) complex. It is found to be involved in the progression and metastasis of several types of tumors. It is found to participate in the regulation of T-cell functions.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70617,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation orthogonal RNAseq
recombinant expressionapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence SSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVK conjugate unconjugated UniProt accession no. P17931, shipped in wet ice storage temp. 20°C Gene Information human ... LGALS3(3958)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGALS3BP antibody produced in rabbit HPA000554-100UL
Human Protein Atlas Number: HPA000554 Human Protein Atlas characterization data ImmunogenGalectin-3-binding protein precursor recombinant protein epitope signature tag (PrEST)
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76118,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS conjugate unconjugated UniProt accession no. Q08380, shipped in wet ice storage temp. 20°C Gene Information human ... LGALS3BP(3959)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGALS4 antibody produced in rabbit
Human Protein Atlas Number: HPA031184 Human Protein Atlas characterization data
Кат. номер HPA031184-100UL HPA031184-25UL Immunogenlectin, galactoside-binding, soluble, 4ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88915,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunohistochemistry: 1:50- 1:200 isotype IgG immunogen sequence PGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSS conjugate unconjugated UniProt accession no. P56470, shipped in wet ice storage temp. 20°C Gene Information human ... LGALS4(3960)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGALS7 antibody produced in rabbit HPA001549-100UL
Human Protein Atlas Number: HPA001549 Human Protein Atlas characterization data ImmunogenGalectin-7 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
LGALS7 (lectin, galactoside-binding, soluble, 7) gene encodes a β-galactoside-binding protein that is involved in mediating cell-cell and cell-matrix interactions for normal growth control. The expression of this protein stimulates caspase-3 activity and poly (ADP-ribose) polymerase cleavage, leading to initiation of apoptotic pathway. The protein contains a carbohydrate binding domain and a short N-terminal sequence.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77459,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:200-1:500 immunogen sequence PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... LGALS7(3963)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGALS8 antibody produced in rabbit
Human Protein Atlas Number: HPA030491 Human Protein Atlas characterization data
Кат. номер HPA030491-100UL HPA030491-25UL Immunogenlectin, galactoside-binding, soluble, 8 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86531,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence PFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASS conjugate unconjugated UniProt accession no. O00214, shipped in wet ice storage temp. 20°C Gene Information human ... LGALS8(3964)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGALS9 antibody produced in rabbit
Human Protein Atlas Number: HPA047218 Human Protein Atlas characterization data
Кат. номер HPA047218-100UL HPA047218-25UL Immunogenlectin, galactoside-binding, soluble, 9ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83260,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
orthogonal RNAseqapplication(s) immunohistochemistry: 1:50- 1:200","western blot: 0.04-0.4 µg/mL immunogen sequence RFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTIN conjugate unconjugated UniProt accession no. O00182, shipped in wet ice storage temp. 20°C Gene Information human ... LGALS9(3965)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGI2 antibody produced in rabbit
Human Protein Atlas Number: HPA017140 Human Protein Atlas characterization data
Кат. номер HPA017140-100UL HPA017140-25UL General descriptionLGI2 (leucine-rich repeat LGI family, member 2) is a leucine-rich repeat-containing protein. The family of leucine-rich repeat protein consists of four members, LGI1, LGI2, LGI3, and LGI4. It is localized in the endoplasmic reticulum. It is a 92-100kDa protein. Mutation in LGI2 causes lateral temporal lobe epilepsy.ImmunogenLeucine-rich repeat LGI family member 2 precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72109,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence DLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNKFECDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEKKLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMENCMVLEW conjugate unconjugated UniProt accession no. Q8N0V4, shipped in wet ice storage temp. 20°C Gene Information human ... LGI2(55203)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGMN antibody produced in rabbit
Human Protein Atlas Number: HPA001426 Human Protein Atlas characterization data
Кат. номер HPA001426-100UL HPA001426-25UL General descriptionLGMN (legumain) is a cysteine lysosomal endoprotease that cleaves substrates at specific aspartate or asparagine residues. It is predominantly expressed in placenta and kidney, and is also found in brain, heart, liver, spleen and testis. It has a caspase-like fold, with a central six-stranded β-sheet (β1–β6), flanked by five major α-helices (α1–α5). The active form is a monomer. The enzyme is activated autocatalytically by acidic pH. The gene is localized to chromosome 14q32.1.ImmunogenLegumain precursor recombinant protein epitope signature tag (PrEST)ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
Biochem/physiol Actions
LGMN (Legumain) gene encodes a cysteine protease that specifically catalyzes the hydrolysis of asparaginyl bonds. It is involved in the processing of proteins (bacterial and endogenous) for MHC class II presentation in the lysosomal/endosomal systems. Overexpression of legumain has been observed in several solid tumors. It serves as a prognostic marker and a potential therapeutic target is certain cancers, such as gastric carcinoma.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70368,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence QGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY conjugate unconjugated UniProt accession no. Q99538, shipped in wet ice storage temp. 20°C Gene Information human ... LGMN(5641)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LGSN antibody produced in rabbit
Human Protein Atlas Number: HPA039983 Human Protein Atlas characterization data
Кат. номер HPA039983-100UL HPA039983-25UL Immunogenlengsin, lens protein with glutamine synthetase domainApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST89397,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500 immunogen sequence VSRSKTIPAHFFQEKVSHGVCMPRGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPRY conjugate unconjugated UniProt accession no. Q5TDP6, shipped in wet ice storage temp. 20°C Gene Information human ... LGSN(51557)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LHFPL5 antibody produced in rabbit
Human Protein Atlas Number: HPA055110 Human Protein Atlas characterization data
Кат. номер HPA055110-100UL HPA055110-25UL Immunogenlipoma HMGIC fusion partner-like 5 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85870,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence FVLGYRQDKLLPDDYKADGTEEV conjugate unconjugated UniProt accession no. Q8TAF8, shipped in wet ice storage temp. 20°C Gene Information human ... LHFPL5(222662)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LHPP antibody produced in rabbit
Human Protein Atlas Number: HPA009163 Human Protein Atlas characterization data
Кат. номер HPA009163-100UL HPA009163-25UL General descriptionLHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase) gene is localized to human chromosome 10. This protein was initially isolated from swine brain. The mRNA is present in brain, kidney and liver.ImmunogenPhospholysine phosphohistidine inorganic pyrophosphate phosphatase recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
LHPP (phospholysine phosphohistidine inorganic pyrophosphate phosphatase) catalyzes the hydrolysis of P-N bonds in phosphohistidine and phospholysine. It also catalyzes the hydrolysis of P-N or P-O bonds in imidodiphosphate and pyrophosphate, respectively, but with lesser efficiency. Studies in Utah and Ashkenazi populations show that single nucleotide polymorphisms (SNPs) in this gene are associated with MDD (major depressive disorder). Its interaction with the gene HTR1A (5-hydroxytryptamine (serotonin) receptor 1A) is suggested to play a part in the pathogenesis of MDD. Up-regulation of this protein is linked with hyperthyroidism.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71206,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human, mouse, rat packaging antibody small pack of 25 µL enhanced validation independent application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence LISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVD conjugate unconjugated UniProt accession no. Q9H008, shipped in wet ice storage temp. 20°C Gene Information human ... LHPP(64077)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LHPP Antibody, clone 3B18 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1050-25UL ZRB1050-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 3B18 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP).ImmunogenHis-tagged full-length recombinant human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP).ApplicationWestern Blotting Analysis: A 1:1,000 dilution from a representative lot detected LHPP in lysates from rat kidney, human liver, and COS-7 cells.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected LHPP in A431 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected LHPP in human liver tissue sections.
Affinity Binding Assay: A representative lot of this antibody bound human recombinant LHPP with a KD of 8.6 x 10-7 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-LHPP, clone 3B18 ZooMAb, Cat. No. ZRB1050, is a recombinant Rabbit monoclonal antibody that specifically targets LHHP and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (UniProt: Q9H008; also known as EC:3.6.1.1, Hlhpp, LHPP) is encoded by the LHPP gene (Gene ID: 64077) in human. LHPP is an evolutionarily conserved member of the HAD-like hydrolase superfamily with phosphatase activity. It displays broad substrate specificity and can hydrolyze imidodiphosphate, 3-phosphohistidine, and 6-phospholysine. It can also hydrolyze inorganic diphosphate, but with reduced efficiency. It has two substrate binding sites that are located in amino acids 17-19 and 54-55. Its higher expression has been reported in brain, and somewhat lower expression in liver and kidney. LHHP expression is shown to be down regulated in liver and bladder cancers and knockdown of LHPP promotes the proliferation and growth of tumor cells. Conversely, sustained hepatic expression of LHPP in a murine model of hepatocellular carcinoma is reported to reduce tumor burden and prevent the loss of liver function. Silencing of LHHP can lead to enhanced phosphorylation of Akt and p65 and up-regulates the level of Bcl-2 and cyclin D1. Two isoforms of LHPP have been described that are produced by alternative splicing. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Hindupur, SK., et al. (2018). Nature. 555(7698); 678-682; Li, Y., et al. (2019). Biosci Rep. 39(7); BSR20182270.).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
0.3 mg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 3B18, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 29.16 kDa, observed mol wt ~30 kDa species reactivity human, rat, monkey packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LHX9 antibody produced in rabbit
Human Protein Atlas Number: HPA009695 Human Protein Atlas characterization data
Кат. номер HPA009695-100UL HPA009695-25UL General descriptionLHX9 (LIM homeobox 9) is a transcription factor belonging to a family of developmental regulators. It is expressed in the brain of mouse embryos, with predominant expression in diencephalon, telencephalic vesicles, and dorsal mesencephalon. This gene is localized to human chromosome 1 and is highly conserved among species.ImmunogenLIM/homeobox protein Lhx9 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Hypermethylation of LHX9 (LIM homeobox 9) leading to suppressed mRNA expression is observed in pediatric high-grade gliomas (HGGs). It is also silenced by hypermtheylation in pediatric malignant astrocytomas and this is linked with migration and invasiveness in gliomas. It might be implicated in differentiation control of multiple neural cell types. LHX9 and LHX1 function as a binary switch, which controls the rostral and caudal longitudinal turning of the caudal commissural axons. LHX9 promotes rostral turning.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86963,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence GCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLAL conjugate unconjugated UniProt accession no. Q9NQ69, shipped in wet ice storage temp. 20°C Gene Information human ... LHX9(56956)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LILRB4 Antibody, clone 1H12 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1113-25UL ZRB1113-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1H12 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects human Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4). It targets an epitope within 19 amino acids from the extracellular domain.ImmunogenKLH-conjugated linear peptide corresponding to 19 amino acids from the extracellular domain of human Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4).ApplicationAnti-LILRB4, clone 1H12 ZooMAb®, Cat. No. ZRB1113, is a rabbit recombinant monoclonal antibody that specifically targets LILRB4 and is tested for use in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in MDA-MB-435 lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected LILRB4 in MDA-MB-435 cell lysate.
Tested Applications
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected LILRB4 in NK-92 cells.
Affinity Binding Assay: A representative lot of this antibody bound LILRB4 peptide with a KD of 2.5 x 10-7 in an affinity binding assay.
Flow Cytometry Analysis: 1 µg from a representative lot detected LILRB4 in NK-92 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Leukocyte immunoglobulin-like receptor subfamily B member 4 (UniProt: Q8NHJ6; also known as CD85 antigen-like family member K, Immunoglobulin-like transcript 3, ILT-3, Leukocyte immunoglobulin-like receptor 5, LIR-5, Monocyte inhibitory receptor HM18, CD85k, LILRB4) is encoded by the LILRB4 (Gene ID: ILT3, LIR5) gene (Gene ID: 11006) in human. LILRB4 is a single-pass type I membrane protein that serves as a receptor for class I MHC antigens and recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles. It is involved in the downregulation of the immune response and the development of tolerance, such as towards transplants. It is reported to inhibit receptor-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions. LILRB4 expression has been reported in monocytes, macrophages, dendritic cells, lung, natural killer cells and B-cells and is induced upon contact with CD8+ CD28- alloantigen-specific T suppressor (Ts) cells. LILRB4 is also a tumor-associated antigen that is highly expressed on monocytic AML cells where its expression is more specific and can be used to differentiate monocytic AML (M5) from AML M1-M3. It is synthesized with a signal peptide (aa 1-21), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 22-259), a transmembrane domain (aa 260-280), and a cytoplasmic domain (aa 181-448). It contains three copies of immunoreceptor tyrosine-based inhibitor motif (ITIM) that are involved in modulation of cellular responses and the phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: John, S. et al. (2018). Mol. Therap. 26(10); 2487-2495).
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1H12, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt ~ 49.36 kDa, observed mol wt ~ 50 kDa species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, flow cytometry: suitable, immunocytochemistry: suitable, western blot: suitable isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LILRB5 antibody produced in rabbit
Human Protein Atlas Number: HPA012069 Human Protein Atlas characterization data
Кат. номер HPA012069-100UL HPA012069-25UL ImmunogenLeukocyte immunoglobulin-like receptor subfamily B member 5 precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
LILRB5 (leukocyte immunoglobulin-like receptor subfamily B member 5) is a cell-surface immunoregulatory receptor belonging to the leukocyte Ig-like receptors (LIRs). It is expressed on the monocytes, B cells and also on dendritic cells and NK cells to lesser extent. Generally, it consists of two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). It directly interacts with the MHC class I antigens to perform in the immune system regulation. It also plays a role in the mast cell-dependent inflammatory responses.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71741,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
orthogonal RNAseqapplication(s) immunohistochemistry: 1:50-1:200 immunogen sequence PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG conjugate unconjugated UniProt accession no. O75023, shipped in wet ice storage temp. 20°C Gene Information human ... LILRB5(10990)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LIMA1 antibody produced in rabbit
Human Protein Atlas Number: HPA023871 Human Protein Atlas characterization data
Кат. номер HPA023871-100UL HPA023871-25UL ImmunogenLIM domain and actin-binding protein 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST73668,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence ISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKIHKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDS conjugate unconjugated UniProt accession no. Q9UHB6, shipped in wet ice storage temp. 20°C Gene Information human ... LIMA1(51474)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LIMS2 antibody produced in rabbit
Human Protein Atlas Number: HPA058340 Human Protein Atlas characterization data
Кат. номер HPA058340-100UL HPA058340-25UL ImmunogenLIM and senescent cell antigen-like domains 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86172,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence KRLKKLSELTSRKAQPKATDLNSA conjugate unconjugated UniProt accession no. Q7Z4I7, shipped in wet ice storage temp. 20°C Gene Information human ... LIMS2(55679)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LIN28B antibody produced in rabbit
Human Protein Atlas Number: HPA061745 Human Protein Atlas characterization data
Кат. номер HPA061745-100UL HPA061745-25UL Immunogenlin-28 homolog B (C. elegans)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86336,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:2500-1:5000","western blot: 0.04-0.4 µg/mL immunogen sequence QEARAEISERSGRSPQEASSTKSSIAPEEQSKKGPSVQKRKKT conjugate unconjugated UniProt accession no. Q6ZN17, shipped in wet ice storage temp. 20°C Gene Information human ... LIN28B(389421)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LIN37 antibody produced in rabbit
Human Protein Atlas Number: HPA047809 Human Protein Atlas characterization data
Кат. номер HPA047809-100UL HPA047809-25UL Immunogenlin-37 DREAM MuvB core complex componentApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST82839,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 100 biological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50 immunogen sequence PPGDACRSRIPSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILREMYERQ conjugate unconjugated UniProt accession no. Q96GY3, shipped in wet ice storage temp. 20°C Gene Information human ... LIN37(55957)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LINE-1 ORF1p Antibody, clone 4H1 ZooMAb® Mouse Monoclonal
Кат. номер ZMS1066-25UL ZMS1066-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 4H1 is a ZooMAb® mouse recombinant monoclonal antibody that specifically detects LINE-1 retrotransposable element ORF1 protein. It targets an epitope within 10 amino acids from the N-terminal region.ImmunogenA linear peptide corresponding to 10 amino acids from the N-terminal region of human LINE-1 ORF1 protein.ApplicationAnti-LINE-1 ORF1p, clone 4H1 ZooMAb®, Cat. No. ZMS1066, is a recombinant Mouse monoclonal antibody that specifically targets LINE-1 ORF1p and is tested for use in Flow Cytometry, Immunocytochemistry, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in MCF-7 cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected LINE-1 ORF1p in MCF-7 cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected LINE-1 ORF1p in NTERA-2 cell lysate.
Flow Cytometry Analysis: 0.1 µg from a representative lot detected LINE-1 ORF1p in one million MCF-7 cells.
Immunocytochemistry Analysis: A 1:1,000 dilution from a representative lot detected LINE-1 ORF1p in MCF-7 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
LINE-1 retrotransposable element ORF1 protein (UniProt: Q9UN81; also known L1ORF1p, LINE retrotransposable element 1, LINE1 retrotransposable element 1) is encoded by the LIRE1 (also known as LRE1) gene in human. LINE1-ORF 1P is a homotrimeric protein of the transposase 22 family that can also form larger homooligomers. It is mainly a cytoplasmic protein and is enriched in stress granules, but may also be detected in the nucleolus. It contains a coiled coil domain that mediates its homotrimerization. Its RNA recognition motif (RRM) (aa 157-252) in the C-terminal domain are required for its proper RNA-binding activity. LINE1-ORF 1P serves as a nucleic acid-binding protein that is essential for retrotransposition of LINE-1 elements in the genome. It is also reported to function as a nucleic acid chaperone binding its own transcript and therefore preferentially mobilizing the transcript from which they are encoded. Retrotransposition is a shown to be a complex process that involves transcription of the LINE1, transport of its RNA to the cytoplasm, translation of the bicistronic RNA, formation of a ribonucleoprotein particle, its re-import to the nucleus and then target-primed reverse transcription at the integration site. LINE1-ORF 1P expression is consistently detected in p53 mutant tumors, but, little or no expression is detected in Wilms tumors that were normal for p53. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Goodier, JL et al. (2013). Nucleic Acids Res. 41(15): 7401-7419).
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200, biological source mouse recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 4H1, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt ~ 40.06 kDa, observed mol wt ~40 kDa species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) flow cytometry: suitable, immunocytochemistry: suitable, western blot: suitable isotype IgG1 conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-Linear Ubiquitin Antibody, clone 1E3 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB2114-4X25UL ZRB2114-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.SpecificityClone 1E3 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects linear ubiquitinsImmunogenRecombinant protein corresponding to all linear ubiquitin linkages.ApplicationQuality Control Testing
Evaluated by Western Blotting with linear Ub, Ub K11, Ub K48, and Ub K63.
Western Blotting Analysis: A 1:20,000 dilution of this antibody detected Ubiquitin in Linear Ub, but not Ub K11, Ub K48, Ub K63.
Tested applications
Affinity Binding Assay: A representative lot of this antibody bound Ubiquitin with a KD of 4.5 x 10-8 in an affinity binding assay.
Immunocytochemistry Analysis: A 1:1,000 dilution from a representative lot detected Ubiquitin in HeLa treated with MG132.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Linear Ubiquitin, clone 1E3 ZooMAb®, Cat. No. ZRB2114, is a recombinant Rabbit monoclonal antibody that detects Ubiquitin and is tested for use in Affinity Binding Assay, Immunocytochemistry, and Western Blotting.
Target description
Ubiquitin (Ub) is initially produced as a 229 amino acids Polyubiquitin-B (UniProt: P0CG47) precursor protein encoded by the UBB gene (Gene ID: 7314) or a 685 amino acids Polyubiquitin-C precursor protein (UniProt: P0CG48) encoded by the UBC gene (Gene ID: 7316) in human. Ub exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Ub is linked covalently via its carboxyl terminus (Gly76) to usually Lys residues in target proteins. In a given target Lys residue can be linked to one single Ub molecule (monoubiquitylated) or to a chain of Ub molecules (polyubiquitylated). In a polyUb chain, Ub molecules can be linked through one of the seven Lys residues (K6, K11, K27, K29, K33, K48, and K63) or through the Ub N-terminus Met1 residue (which generates linear chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked. For example, lysine 6-linked may be involved in DNA repair; lysine 11-linked is involved in endoplasmic reticulum-associated degradation (ERAD) and in cell-cycle regulation, and lysine 29-linked is involved in lysosomal degradation. Lysine 48-linked chains mark proteins for proteasomal degradation, while lysine 63-linked chains are involved in endocytosis, DNA-damage responses, and in signaling leading to activation of the transcription factor NF-kappa-B. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200 recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1E3, recombinant monoclonal description recombinant, expressed in HEK 293 cells product line ZooMAb® form lyophilized mol wt calculated mol wt Variable species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) affinity binding assay: suitable","immunocytochemistry: suitable","western blot: suitable isotype IgG epitope sequence Unknown conjugate unconjugated Protein ID accession no. NP_061828.1, UniProt accession no. P0CG47 and P0CG48, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LINGO1 antibody produced in rabbit
Human Protein Atlas Number: HPA074653 Human Protein Atlas characterization data
Кат. номер HPA074653-100UL HPA074653-25UL Immunogenleucine rich repeat and Ig domain containing 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST93241,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV conjugate unconjugated UniProt accession no. Q96FE5, shipped in wet ice storage temp. 20°C Gene Information human ... LINGO1(84894)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LIPA antibody produced in rabbit
Human Protein Atlas Number: HPA057052 Human Protein Atlas characterization data
Кат. номер HPA057052-100UL HPA057052-25UL Immunogenlipase A, lysosomal acid, cholesterol esteraseApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87790,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500 immunogen sequence FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF conjugate unconjugated UniProt accession no. P38571, shipped in wet ice storage temp. 20°C Gene Information human ... LIPA(3988)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LIPF antibody produced in rabbit
Human Protein Atlas Number: HPA045930 Human Protein Atlas characterization data
Кат. номер HPA045930-100UL HPA045930-25UL Immunogenlipase, gastric recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST80397,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
orthogonal RNAseqapplication(s) immunohistochemistry: 1:1000-1:2500","western blot: 0.04-0.4 µg/mL immunogen sequence GGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDK conjugate unconjugated UniProt accession no. P07098, shipped in wet ice storage temp. 20°C Gene Information human ... LIPF(8513)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LMAN2 antibody produced in rabbit HPA003927-100UL
Human Protein Atlas Number: HPA003927 Human Protein Atlas characterization data ImmunogenVesicular integral-membrane protein VIP36 precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Vesicular integral-membrane protein VIP36 is a protein encoded by the LMAN2 gene in humans. It is an intracellular lectin that acts as a putative cargo receptor, cycles between the endoplasmic reticulum (ER) and the Golgi apparatus. It may act as a cargo receptor in the transport and sorting of glycoproteins. It binds to glycoproteins that retain the intact D1 mannosyl branch in the cis-Golgi network and recycles to the endoplasmic reticulum where, due to higher pH, it releases its cargos, and may contribute to the quality control of glycoproteins or secretory proteins. This gene is a receptor with homology to plant leguminous lectins in its luminal region.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST86414,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence GNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKD conjugate unconjugated UniProt accession no. Q12907, shipped in wet ice storage temp. 20°C Gene Information human ... LMAN2(10960)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LMCD1 antibody produced in rabbit
Human Protein Atlas Number: HPA024059 Human Protein Atlas characterization data
Кат. номер HPA024059-100UL HPA024059-25UL ImmunogenLIM and cysteine-rich domains protein 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85057,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence QLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGA conjugate unconjugated UniProt accession no. Q9NZU5, shipped in wet ice storage temp. 20°C Gene Information human ... LMCD1(29995)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LMNA antibody produced in rabbit
MDL number: MFCD01633588 Human Protein Atlas Number: HPA006660 Human Protein Atlas characterization data
Кат. номер HPA006660-100UL HPA006660-25UL ImmunogenLamin-A/C recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70720,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity mouse, human, rat packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence EVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRE conjugate unconjugated UniProt accession no. P02545, shipped in wet ice storage temp. 20°C Gene Information human ... LMNA(4000)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-LMNB1 antibody produced in rabbit
Human Protein Atlas Number: HPA050524 Human Protein Atlas characterization data
Кат. номер HPA050524-100UL HPA050524-25UL Immunogenlamin B1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88562,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 isotype IgG immunogen sequence RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK conjugate unconjugated UniProt accession no. P20700, shipped in wet ice storage temp. 20°C Gene Information human ... LMNB1(4001)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LMNB2 antibody produced in rabbit
Human Protein Atlas Number: HPA047863 Human Protein Atlas characterization data
Кат. номер HPA047863-100UL HPA047863-25UL Immunogenlamin B2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88902,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:5000-1:10000 isotype IgG immunogen sequence DEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLM conjugate unconjugated UniProt accession no. Q03252, shipped in wet ice storage temp. 20°C Gene Information human ... LMNB2(84823)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LMO7 antibody produced in rabbit
Human Protein Atlas Number: HPA020923 Human Protein Atlas characterization data
Кат. номер HPA020923-100UL HPA020923-25UL General descriptionThe gene LMO7 (LIM domain only protein 7) is mapped to human chromosome 13q22.2. LMO7 is expressed in early stages of muscle and heart development. The protein localizes in the nucleus and cytoplasm.ImmunogenLIM domain only protein 7 recombinant protein epitope signature tag (PrEST)ApplicationApplications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper),
Anti-LMO7 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
LMO7 (LIM domain only protein 7) is responsible for activation of myocardin-related transcription factors (MRTFs) and thereby regulates actin cytoskeleton and breast cancer cell migration. LMO7 is linked with Emery-Dreifuss muscular dystrophy.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST85228,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY conjugate unconjugated UniProt accession no. Q8WWI1, shipped in wet ice storage temp. 20°C Gene Information human ... LMO7(4008)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LMOD1 antibody produced in rabbit
Human Protein Atlas Number: HPA030097 Human Protein Atlas characterization data
Кат. номер HPA030097-100UL HPA030097-25UL Immunogenleiomodin 1 (smooth muscle) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77036,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) immunohistochemistry: 1:50- 1:200 immunogen sequence KRGTGNTDTKKDDEKVKKNEPLHEKEAKDDSKTKTPEKQMPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFT conjugate unconjugated UniProt accession no. P29536, shipped in wet ice storage temp. 20°C Gene Information human ... LMOD1(25802)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LMOD2 antibody produced in rabbit
Human Protein Atlas Number: HPA051039 Human Protein Atlas characterization data
Кат. номер HPA051039-100UL HPA051039-25UL Immunogenleiomodin 2 (cardiac) recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST84557,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200-1:500 immunogen sequence RELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYT conjugate unconjugated UniProt accession no. Q6P5Q4, shipped in wet ice storage temp. 20°C Gene Information human ... LMOD2(442721)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-LMTK3
Human Protein Atlas Number: HPA077070 Human Protein Atlas characterization data
Кат. номер HPA077070-100UL HPA077070-25UL ImmunogenRecombinant protein corresponding to lemur tyrosine kinase 3
Sequence
CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDPApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:200-1:500 conjugate unconjugated UniProt accession no. Q96Q04, shipped in wet ice storage temp. 20°C Gene Information human ... LMTK3(114783)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену
Получите коммерческое предложение в течение 1 часа
Менеджер подготовит коммерческое предложение и позвонит, если понадобится уточнить детали вашего заказа
Анна Гловацкая
Менеджер по работе с клиентами
С 2010 года мы поставляем оборудование с заводов Европы. Берем на себя все — от подбора оборудования до внедрения на предприятии
Все сотрудники имеют высшее образование, закончили ведущие химические вузы страны, такие как РХТУ им Менделеева.
У большинства компаний срок ожидания составляет 10-12 недель.
Оборудование хранится на сухом отапливаемом складе, где поддерживается ровная температура.
Работаем с PonyExpress и Деловыми линиями. Вы также можете выбрать свою транспортную компанию или забрать товар со склада в Москве.
В случае любых неполадок за свой счет выполним ремонт в сервисном центре или на заводе-изготовителе. Или бесплатно заменим прибор на новый.
Производим пуско-наладку оборудования, валидацию, обучение сотрудников. Если нужно, привлекаем инженеров с заводов- изготовителей.
