Protein Biology

HPA044802 Human Protein Atlas characterization data

major facilitator superfamily domain containing 8 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84093,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR
conjugate	unconjugated
UniProt accession no.	Q8NHS3,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MFSD8(256471)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MGA antibody produced in rabbit

HPA042278 Human Protein Atlas characterization data

MAX gene associated recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86919,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:1000-1:2500
immunogen sequence	KLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFELSGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKHLKGPLTRKCVGASQECKKEADEQLIKETKTCQENSDVFQQEQGISDLLGKSGITEDARVLKTECDSWSRIS
conjugate	unconjugated
UniProt accession no.	Q8IWI9,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MGA(23269)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MGAM antibody produced in rabbit

HPA002270 Human Protein Atlas characterization data

MGAM (maltase-glucoamylase) belongs to the members of the glycoside hydrolase 31 family (GH31). It has two catalytic domains at both the ends: N-terminal membrane-proximal domain (ntMGAM) and C-terminal luminal domain (ctMGAM).

Maltase-glucoamylase, intestinal recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MGAM (maltase-glucoamylase) is mainly involved in the terminal starch digestion and breakdown of dietary sugars. In addition to the exo-glucosidase activities against α-1,4-linked maltose substrates, it has additional activity towards α-1,6 linkages of starch branch points and α-1,2 linkage of sucrose.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST85131,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:1000- 1:2500
immunogen sequence	VYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSGVP
conjugate	unconjugated
UniProt accession no.	O43451,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MGAM(8972)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MGAM2 antibody produced in rabbit

HPA055697 Human Protein Atlas characterization data

maltase-glucoamylase 2 (putative)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST83853,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:1000-1:2500
immunogen sequence	PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND
conjugate	unconjugated
UniProt accession no.	Q2M2H8,
shipped in	wet ice
storage temp.	20°C

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MGARP antibody produced in rabbit

HPA015994 Human Protein Atlas characterization data

mitochondria-localized glutamic acid-rich protein

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST90607,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:2500-1:5000
immunogen sequence	YKTVTSDQAKHTEHKTNLKEKTKAEIHPFQGEKENVAETEKASSEAPEELIVEAEVVDAEESPSATVVVIKEASACPGHVEAAPETTAVSAETGPEVTDAAA
conjugate	unconjugated
UniProt accession no.	Q8TDB4,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MGARP(84709)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MGAT4A antibody produced in rabbit

HPA007608 Human Protein Atlas characterization data

MGAT4A (mannosyl (-1,3-)-glycoprotein -1,4-N-acetylglucosaminyltransferase, isozyme A) gene is mapped to human chromosome 2q12. The enzyme contains 535-aminoacids and is encoded by an mRNA having 16 exons interspaced by 15 introns. It is predominantly expressed in spleen, thymus, peripheral blood leukocytes, lymph node, prostate, pancreas, and small intestine.

mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, isozyme A recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MGAT4A (mannosyl (-1,3-)-glycoprotein -1,4-N-acetylglucosaminyltransferase, isozyme A) gene encodes a glycosyltransferase that mediates the formation of tri- and multiantennary branching structures on membrane proteins in the Golgi apparatus. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a -1,4 linkage to the core mannose residues of N-linked glycans. It mediates GLUT2 glycosylation and facilitates the transport of glucose by pancreatic cells. Increased levels of this protein is observed in white cells of peripheral blood of Type 2 diabetes patients. The enzyme is involved in the regulation of the availability of serum glycoproteins, oncogenesis, and cell differentiation.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71318,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	LLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQ
conjugate	unconjugated
UniProt accession no.	Q9UM21,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MGAT4A(11320)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MGAT4D antibody produced in rabbit

HPA036523 Human Protein Atlas characterization data

MGAT4 family, member D

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST79879,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:200-1:500
immunogen sequence	FQVKVCDAGEDLRNCMKRKKQIRIQYKPSL
conjugate	unconjugated
UniProt accession no.	A6NG13,
shipped in	wet ice
storage temp.	20°C

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-MGLL antibody produced in rabbit

HPA011994 Human Protein Atlas characterization data

Monoglyceride lipase recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MGLL (Monoglyceride lipase) is a serine hydrolase with a molecular weight of 33,218. It is involved in the inactivation of the primary endocannabinoid 2-arachidonoylglycerol (2-AG). In the nervous system, it facilitates the hydrolytic conversion of stored triglycerides such as primary endocannabinoid 2-arachidonoylglycerol and related monoacylglycerols into fatty acids and glycerol to release the arachidonic acid. It also controls the rate and isomer preferences during monoacylglycerol hydrolysis. In cancer cells, its high expression helps to control the level of fatty acid and in turn promotes cancer cell migration, invasion, and tumor growth.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70462,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:20- 1:50
immunogen sequence	RQHIMETGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSM
conjugate	unconjugated
UniProt accession no.	Q99685,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MGLL(11343)

ZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-mGluR5 Antibody, clone 1F11 ZooMAb® Rabbit Monoclonal

Specificity

Clone 1F11 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Metabotropic glutamate receptor 5 (mGluR5). It targets an epitope within 23 amino acids from the C-terminal region.

KLH-conjugated linear peptide corresponding to 23 amino acids the C-terminal region of human Metabotropic glutamate receptor 5 (mGluR5).

This rabbit recombinant monoclonal Anti-mGluR5, clone 1F11 ZooMAb® Rabbit Monoclonal, Cat. No. ZRB1270 is used in Western Blotting, Immunohistochemistry (Paraffin), Immunocytochemistry and Affinity Binding Assay, for the detection of mGluR5.
Quality Control Testing
Evaluated by Western Blotting in Rat brain microsome.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected mGluR5 in Rat brain microsome.
Tested applications
Affinity Binding Assay: A representative lot of this antibody bound mGluR5 peptide with a KD of 2.0 x 10-8 in an affinity binding assay.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected mGluR5 in E18 rat cortical cells.
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected mGluR5 in rat brain tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Metabotropic glutamate receptor 5 (UniProt: P41594; also known as mGluR5) is encoded by the GRM5 (also known as GPRC1E, MGLUR5) gene (Gene ID: 2915) in human. Glutamate receptors can be grouped into ionotropic receptors and metabotropic receptors. Excitotoxic effects of glutamate analogs are primarily achieved through the activation of the ionotropic receptors. Glutamate can also activate metabotropic receptors that couple GTP-binding proteins to intracellular second messengers. These receptors are distributed throughout the central nervous system and are located at synaptic as well as extra-synaptic sites in neurons and glia. Metabotropic receptors contain a large extracellular N-terminal domain known as the Venus flytrap domain (VFD) that contains the glutamate-binding site and has two lobes that sit one atop the other and bind glutamate in a cleft between the two lobes. The VFD dimer can exist in open-open, open-closed, or in closed-closed state. The open-open state is an inactive conformation and is stabilized by antagonists. At least eight metabotropic glutamate receptors (mGluR1-8) have been reported. They are classified into three groups based on their sequence homology, agonist pharmacology, and coupling to intracellular transduction mechanisms. The mGluR1 and mGluR5 belong to group I and these receptors are coupled to post-synaptic inositol phosphate metabolism. They couple to Gq/G11 and activate phospholipase C that hydrolyzes phosphoinositides to generate inositol 1, 4, 5-trisphosphate (IP3) and diacyl- glycerol (DAG), both of which participate in the activation of protein kinase C. Activation of Group I receptors leads to depolarization and increases neuronal excitability. mGluR1 is present at high levels in the cerebellum and thalamus and mGluR5 is found in superficial cortical layers and the olfactory bulb. The activation of mGluR1 generates a single spike in Ca2+ concentrations, whereas mGluR5 activation leads to Ca2+ oscillations via phosphorylation/dephosphorylation cycles. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

ZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

expressed in HEK 293 cells

antibody form

purified antibody

antibody product type

primary antibodies

clone

1F11, recombinant monoclonal

description

recombinant, expressed in HEK 293 cells

calculated mol wt 132.47 kDa","observed mol wt ~155 kDa

species reactivity

rat

species reactivity (predicted by homology)

bovine, mouse, human

packaging

antibody small pack of 25 µL

enhanced validation

recombinant expression

application(s)

Clone 2N19 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects human Methylated-DNA-protein-cysteine methyltransferase (MGMT).

Anti-MGMT Antibody, clone 2N19 ZooMAb® Rabbit Monoclonal

His-tagged full-length recombinant human Methylated-DNA-protein-cysteine methyltransferase (MGMT).

Anti-MGMT, clone 2N19 ZooMAb®, Cat. No. ZRB1363, is a recombinant Rabbit monoclonal antibody that specifically targets MGMT and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in Jurkat cell lysate.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected MGMT in Jurkat cell lysate.
Tested applications
Western Blotting Analysis: A 1:10,000 dilution from a representative lot detected MGMT in HeLa and MCF-7 cell lysates.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected MGMT in HeLa cells.
Affinity Binding Assay: A representative lot of this antibody bound MGMT peptide with a KD of 1.3 x 10-8 in an affinity binding assay.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected MGMT in human testis and human stomach tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Methylated-DNA-protein-cysteine methyltransferase (UniProt: P16455; also known as EC:2.1.1.63, 6-O-methylguanine-DNA methyltransferase, MGMT, O-6-methylguanine-DNA-alkyltransferase) is encoded by the MGMT gene (Gene ID: 4255) in human. MGMT is a ubiquitous DNA repair suicide enzyme that removes the cytotoxic DNA adducts O6-methylguanine and O6-chloroethylguanine induced by methylating and chloroethylating agents. It repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. Hence, it serves as a major contributor to cellular protection from the mutagenic, carcinogenic, and cytotoxic effects of DNA alkylation. MGMT is reported to be frequently silenced due to abnormal methylation in cancer cells. However, it also makes tumor cells more sensitive to radiation therapy and certain alkylating drugs. In adults, epigenetic silencing of MGMT by promoter methylation has been shown to improve the outcome in subjects with glioblastoma multiforme receiving temozolomide, a methylating agent. Higher activity of MGMT in cancer cells is reported to be one of the major mechanisms of cancer drug resistance that which counteracts chemotherapy-induced DNA alkylation. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Fan, C-H., et al. (2013). Cell Death Dis. 4; e876).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

Quality Level	200
biological source	rabbit
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	2N19, recombinant monoclonal
description	recombinant, expressed in HEK 293 cells
product line	ZooMAb^®
form	lyophilized
mol wt	calculated mol wt 21.65 kDa","observed mol wt ~22 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	affinity binding assay: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable
isotype	IgG
epitope sequence	Unknown
conjugate	unconjugated
Protein ID accession no.	NP_002403,
UniProt accession no.	P16455,
shipped in	ambient
storage temp.	2-8°C

Anti-MGST1 antibody produced in rabbit

HPA044840 Human Protein Atlas characterization data

microsomal glutathione S-transferase 1 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84914,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	FYRLTRKVFANPEDCVAFGKGENAKKYLRTDDR
conjugate	unconjugated
UniProt accession no.	P10620,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MGST1(4257)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MIA3 antibody produced in rabbit

HPA055922 Human Protein Atlas characterization data

Transport and Golgi organisation protein 1 (TANGO) is also termed as melanoma inhibitor protein 3 (MIA3). It is a member of the melanoma inhibitory activity (MIA) gene family. MIA3 gene encodes a 14 kDa protein. MIA3 is located on human chromosome 1q41.

melanoma inhibitory activity family, member 3

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Transport and Golgi organisation protein 1 (TANGO)/ melanoma inhibitor protein 3 (MIA3) is essential for the transport of collagen VlI (COL7A1) from the endoplasmic reticulum. It acts as a tumor suppressive gene of malignant melanoma. TANGO may stimulate angiogenesis and lymphangiogenesis inOSCC (oral squamous cell carcinoma).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST83592,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	DSKQGKPQSATDYSDPDNVDDGLFIVDIPKTNNDKEVNAEHHIKGKGRGVQESKRGLVQDETELEDENQEGMTVHSSVHSNNLNSMPA
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	Q5JRA6,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MIA3(375056)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MIB2 antibody produced in rabbit

HPA068322 Human Protein Atlas characterization data

mindbomb E3 ubiquitin protein ligase 2

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST92791,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:200-- 1:500
immunogen sequence	PNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQ
conjugate	unconjugated
UniProt accession no.	Q96AX9,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MIB2(142678)

pictograms	GHS07
signalword	Warning
hcodes	H315 - H319
pcodes	P305 + P351 + P338
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 4F8 is a ZooMAb rabbit recombinant monoclonal antibody that detects MHC class I polypeptide-related sequence A (MICA). It targets an epitope within the extracellular domain.

Anti-MICA Antibody, clone 4F8 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 17 amino acids from the extracellular domain of human MHC class I polypeptide-related sequence A (MICA).

Anti-MICA, clone 4F8 ZooMAb, Cat. No. ZRB1697, is a recombinant Rabbit monoclonal antibody that targets in MICA and is tested for use in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Quality Control Testing
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected MICA in NIH3T3 cell lysate.Tested applicationsWestern Blotting Analysis: A 1:1,000 dilution from a representative lot detected MICA in HeLa and L6 cell lysates.Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected MICA in K562 cells.Flow Cytometry Analysis: 1 µg from a representative lot detected MICA in one million K562 cells.Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected MICA in human pancreas and human kidney tissue sections.Affinity Binding Assay: A representative lot of this antibody bound MICA peptide with a KD of 1.5 x 10-6 in an affinity binding assay.Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
MHC class I polypeptide-related sequence A (UniProt: Q29983; also known as MIC-A) is encoded by the MICA (also known as PERB11.1) gene (Gene ID: 100507436) in human. MIC-A is a single-pass type I membrane protein that act as stress-induced self-antigen that are recognized by gamma-delta T cells and serves as ligands for the KLRK1/NKG2D receptor. It is recognized by cytotoxic gamma-delta T cells expressing the TCR variable region V delta1. It is expressed on the cell surface in gastric epithelium, endothelial cells, and fibroblasts and in the cytoplasm in keratinocytes and monocytes. Its expression has also been reported in tumor cells. It is proteolytically cleaved and released from the cell surface of tumor cells which impairs KLRK1/NKG2D expression and T-cell activation. MIC-A can be induced by heat shock and by exposure to DNA damaging conditions. It is synthesized with a signal peptide (aa 1-23), which is cleaved off in the mature form. Their mature forms contain an extracellular domain (aa 24-307), a transmembrane domain (aa 308-328), and a cytoplasmic domain (aa 329-383). Two isoforms of MIC-A have been described that are produced by alternative splicing. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Groh, V., et al. (1999). Proc. Natl. Acad. Sci USA. 96 (12); 6879-6884).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit
Quality Level	200,
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
clone	recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt 42.92 kDa, observed mol wt ~ 58 kDa
species reactivity	human, mouse, rat
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency Learn more about the Principles of Green Chemistry,.
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	affinity binding assay: suitable, flow cytometry: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
greener alternative category	Aligned,
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 2
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MICAL1 antibody produced in rabbit

HPA030178 Human Protein Atlas characterization data

microtubule associated monoxygenase, calponin and LIM domain containing 1 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST77563,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	VRDLYDVLAKEPVQRNNDKTDTGMPATGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADGLALCALVYRLQPGLLEPSELQGLGALEATAWALKV
conjugate	unconjugated
UniProt accession no.	Q8TDZ2,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MICAL1(64780)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MICALL2 antibody produced in rabbit

HPA025695 Human Protein Atlas characterization data

The gene MICALL2 (MICAL like 2) is mapped to human chromosome 7p22.3. It belongs to the MICAL (molecule interacting with CasL) family of proteins. The protein has a CH (calponin homology) domain, a LIM (Lin11, Isl-1, and Mec-3) domain and a C-terminal coiled-coil (CC) domain.

MICAL-like 2 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MICALL2 (MICAL like 2) is mainly involved in cytoskeleton rearrangements. It binds to F-actin and enhances F-actin crosslinking. In addition, it participates in endocytic recycling of occludin, coordination of assembly junctions and epithelial cell scattering. The MICALL2 gene is upregulated in ovarian cancer and regulates epithelial–mesenchymal transition.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST75143,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:200- 1:500
immunogen sequence	DVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRL
conjugate	unconjugated
UniProt accession no.	Q8IY33,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MICALL2(79778)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 2K9 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects human MHC class I polypeptide-related sequence B (MICB). It targets an epitope within 20 amino acids from the N-terminal region.

Anti-MICB Antibody, clone 2K9 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 20 amino acids from the N-terminal, extracellular domain of human MHC class I polypeptide-related sequence B (MICB).

Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected MICB in HeLa cell lysate.Flow Cytometry Analysis: 0.1 µg from a representative lot detected MICB in HeLa cells.
Immunocytochemistry Analysis: A 1:1,000 dilution from a representative lot detected MICB in HeLa, A431, HepG2, HUVEC, and NIH 3T3 cell lines.
Affinity Binding Assay: A representative lot of this antibody bound MICB peptide with a KD of 1.0 X 10-6 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-MICB, clone 2K9 ZooMAb, Cat No. ZRB1439, is a recombinant Rabbit monoclonal antibody that specifically targets MICB and is tested in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
MHC class I polypeptide-related sequence B (UniProt: Q29980; also known as MIC-B, MICB) is encoded by the MICB (also known as PERB11.2) gene (Gene ID: 4277) in human. MICB is a single-pass type I membrane protein that is widely expressed and acts as a stress-induced self-antigen. It is widely expressed with the exception of the central nervous system. It is also expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. It is synthesized with a signal peptide (aa 1-22), which is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 23-309), a transmembrane domain (aa 310-330), and a cytoplasmic domain (aa 331-383). MICB can be induced by heat shock, oxidative stress, retinoic acid, interferon alpha, and 5-aza-2′-deoxycytidine. Its induction by interferon alpha is impaired in subjects with chronic hepatitis C virus infection. It is recognized by gamma-delta T cells and serves as ligands for the KLRK1/NKG2D receptor. Its binding to KLRK1 leads to cell lysis. Mutations in MICB gene have been linked to Rheumatoid arthritis that is characterized by inflammatory changes in the synovial membranes and articular structures, along with widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in lyophilized from PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
0.3 mg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	2K9, monoclonal, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt 42.65 kDa, observed mol wt 55 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency Learn more about the Principles of Green Chemistry,.
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	affinity binding assay: suitable, flow cytometry: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
greener alternative category	Aligned,
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MICU1 antibody produced in rabbit

HPA037479 Human Protein Atlas characterization data

MICU1 (mitochondrial calcium uniporter regulator 1) is located on human chromosome 10. It codes for a modulator of mitochondrial Ca2+ uptake. MICU1 may act as an oncogene.

mitochondrial calcium uptake 1

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MICU1 (mitochondrial calcium uniporter regulator 1) regulates adenosine triphosphate (ATP) availability by controlling mitochondrial depolarization. It also controls several intracellular processes like Ca2+ homeostasis, apoptosis, proliferation and endoplasmic reticulum (ER) stress.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST89353,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	RNAi knockdown
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL
immunogen sequence	IFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTY
conjugate	unconjugated
UniProt accession no.	Q9BPX6,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MICU1(10367)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Anti-MICU3 antibody produced in rabbit

HPA024771 Human Protein Atlas characterization data

The gene MICU3 (mitochondrial calcium uptake family member 3) is mapped to human chromosome 8p22. The encoded protein has a mitochondrial targeting sequence and two canonical Ca2+-binding EF hands. MICU3 is mainly expressed in the central nervous system. It is a homolog gene of MICU1, which is involved in mitochondrial calcium uptake. It is also referred to as EFHA2 (EF-hand domain-containing family member A2).

EF-hand domain-containing family member A2 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST76300,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100,
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:200-1:500
immunogen sequence	RIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRS
conjugate	unconjugated
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... EFHA2(286097)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MIER1 antibody produced in rabbit

HPA019589 Human Protein Atlas characterization data

MIER1 (Mesoderm induction early response 1) is a nuclear protein isolated from Xenopus laevis embryonic cells as a fibroblast growth factor early response gene. It has two isoforms, MIER1 and . In humans, it is expressed in all tumor cell lines and tumor tissue.

Mesoderm induction early response protein 1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MIER1 (Mesoderm induction early response 1) is a transcriptional regulator that may repress transcription by blocking the function of histone acetyltransferase. It participates in the chromatin remodeling by interacting with Creb-binding protein (CBP). Its N-terminal domain interacts with CBP, which further brings about acidic activation. During transcriptional regulation, it binds to the GAL4 DNA binding domain to repress transcriptional signals. Study shows that MIER1 expression is linked to the neoplastic state of human breast carcinoma.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73798,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEI
conjugate	unconjugated
UniProt accession no.	Q8N108,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MIER1(57708)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MIER2 antibody produced in rabbit

HPA041439 Human Protein Atlas characterization data

mesoderm induction early response 1, family member 2 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST82605,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	SPRVVSCLEHSLCPGEPGLQTTAVVSMGSGDHQFNLAEILSQNYSVRGECEEASRCPDKPKEELEKDFISQSNDMPFDELLALYGYEASDPISDRE
conjugate	unconjugated
UniProt accession no.	Q8N344,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MIER2(54531)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MIF antibody produced in rabbit

HPA003868 Human Protein Atlas characterization data

Macrophage migration inhibitory factor recombinant protein epitope signature tag (PrEST)

These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Anti-MIF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Macrophage migration inhibitory factor (MIF, MMIF and GIF) is a protein encoded by the MIF gene in humans and is mapped to chromosome 10. It is a potent cytokine that plays an important role in the regulation of immune responses. It acts as an integral component of the host antimicrobial alarm system and stress response that promotes the pro-inflammatory functions of immune cells. It is implicated in the pathogenesis of sepsis, and inflammatory and autoimmune diseases. It may also be implicated in both types of diabetes.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73599,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	rat, human, mouse
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:2500-1:5000
immunogen sequence	FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNN
conjugate	unconjugated
UniProt accession no.	P14174,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MIF(4282)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MILR1 antibody produced in rabbit

HPA014347 Human Protein Atlas characterization data

Chromosome 17 open reading frame 60 recombinant protein epitope signature tag (PrEST)

Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100,
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq Learn more about Antibody Enhanced Validation,
application(s)	immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunogen sequence	RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLP
conjugate	unconjugated
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... C17orf60(284021)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MINK1 antibody produced in rabbit

HPA056296 Human Protein Atlas characterization data

misshapen-like kinase 1 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84389,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:50-1:200","western blot: 0.04-0.4 µg/mL
immunogen sequence	ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHL
conjugate	unconjugated
UniProt accession no.	Q8N4C8,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MINK1(50488)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MINOS1 antibody produced in rabbit

HPA059930 Human Protein Atlas characterization data

mitochondrial inner membrane organizing system 1

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST83615,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000
immunogen sequence	RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE
conjugate	unconjugated
UniProt accession no.	Q5TGZ0,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MINOS1(440574)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MIOX antibody produced in rabbit HPA039451-100UL

HPA039451 Human Protein Atlas characterization data

myo-inositol oxygenase

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST78176,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	orthogonal RNAseq recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	PEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGI
conjugate	unconjugated
UniProt accession no.	Q9UGB7,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MIOX(55586)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MIPOL1 antibody produced in rabbit

HPA002893 Human Protein Atlas characterization data

Mirror-image polydactyly gene 1 protein recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70576,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	KTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAIARAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSALIEERDAALSKCKRLEQELHHVKEQNQTSANNMRHLTAENNQ
conjugate	unconjugated
UniProt accession no.	Q8TD10,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MIPOL1(145282)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MIS18A antibody produced in rabbit HPA020585-100UL

HPA020585 Human Protein Atlas characterization data

General description

The gene encoding Mis18-α (MIS18A) is located on human chromosome 21q22.11. It is highly expressed in the testis. It is localized to the centromeres during mitotic exit in anaphase/telophase and stays associated during early G1 phase.

Protein Mis18-alpha recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Mis18-α (MIS18A) is important for localizing centromere protein-A (CENP-A) at the centromere. MIS18A also interacts with Mis18-binding protein 1 (M18BP1). These three proteins are essential for metaphase alignment and proper chromosome segregation. MIS18A has been shown to interact with pp5644 (MaFF-interacting protein) in HeLa cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73868,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100,
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	orthogonal RNAseq Learn more about Antibody Enhanced Validation,
application(s)	immunoblotting: 0.04-0.4 µg/mL, immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:20-1:50
immunogen sequence	MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLEEEAAAAEERPLVF
conjugate	unconjugated
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... C21orf45(54069)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MIS18A antibody produced in rabbit HPA018286-100UL

HPA018286 Human Protein Atlas characterization data

General description

The gene Mis18-α (MIS18A) is mapped to human chromosome 21q22.11. MIS18A is highly expressed in testis. It is localized with the centromeres during mitotic exit beginning in anaphase/telophase and remains associated during early G1.

Protein Mis18-α recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Centromere protein-A (CENP-A) is essential component of centromeres. Mis18-α (MIS18A) is important for localizing CENP-A at the centromere. MIS18A also interacts with M18BP1 (Mis18-binding protein 1). All three, MIS18A, CENP-A and M18BP1 are essential for metaphase alignment and proper chromosome segregation. MIS18A interacts with pp5644 (MaFF-interacting protein) in HeLa cells. Presence of pp5644 inhibits growth and colony formation in HeLa cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73867,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100,
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	orthogonal RNAseq Learn more about Antibody Enhanced Validation,
application(s)	immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:20-1:50
immunogen sequence	KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC
conjugate	unconjugated
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... C21orf45(54069)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

MISP (mitotic spindle positioning) is an actin-binding protein, that belongs to the A-kinase anchoring proteins (AKAP) family. It is also known as C19ORF21. This gene is mapped to human chromosome 19p13.

Anti-MISP antibody produced in rabbit

General description

mitotic spindle positioning

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MISP (mitotic spindle positioning) participates in centrosome clustering. It modulates the conversion of metaphase to anaphase. MISP maintains the stability of astral microtubules. Mutation in MISP gene results in multiple mitotic defects, such as spindle misorientation and a SAC-dependent delay in the metaphase-to-anaphase transition.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST87958,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

MITF (microphthalmia-associated transcription factor) is a basic helix-loop-helix, leucine-zipper transcription factor. It is located on human chromosome 3p13.
Microphthalmia-associated transcription factor (MITF) is a bHLH-ZIP transcription factor that recognizes E-box (CAYRTG) and M-box (TCAYRTG or CAYRTGA) sequences in the promoter regions of target genes. Microphthalmia-associated transcription factor (MITF) is a master regulator in melanocyte proliferation, development, survival and melanoma formation and an essential regulator of osteoclastogenesis.
Rabbit polyclonal anti-MITF antibody recognizes human microphthalmia-associated transcription factor.

Anti-MITF antibody produced in rabbit

MDL number:	MFCD03097016
Human Protein Atlas Number:	HPA003259 Human Protein Atlas characterization data

Microphthalmia-associated transcription factor recombinant protein epitope signature tag (PrEST)

Anti-MITF antibody has been used in immunohistochemistry and chromatin immunoprecipitation.
Rabbit polyclonal anti-MITF antibody is used to tag microphthalmia-associated transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of microphthalmia-associated transcription factor in melanocyte proliferation, development, and survival and the regulation of regulator of osteoclastogenesis.
Biochem/physiol Actions
MITF (microphthalmia-associated transcription factor) participates in the growth and differentiation of melanocytes. Mutations in MITF results in waardenburg syndrome type IIa.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84788,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:500-1:1000
immunogen sequence	HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	O75030,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MITF(4286)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1E2 is a Rabbit recombinant monoclonal antibody that specifically detects Microphthalmia-associated transcription factor (MITF). It targets an epitope within 17 amino acids from the N-terminal half.

Anti-MITF Antibody, clone 1E2 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 17 amino acids from the N-terminal half of human Microphthalmia-associated transcription factor.

Quality Control Testing
Evaluated by Western Blotting in mouse kidney tissue lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected MITF in mouse kidney tissue lysate.
Tested applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected MITF in human kidney tissue lysate.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected MITF in HeLa, A431, HUVEC, and NIH3T3 cells.
Affinity Binding Assay: A representative lot of this antibody bound MITF with a KD of 1.0 x 10-7 in an affinity binding assay.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected MITF in human skin tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-MITF, clone 1E2 ZooMAb®, Cat. No. ZRB1335, is a recombinant Rabbit monoclonal antibody that specifically targets MITF and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Target description
Microphthalmia-associated transcription factor (UniProt: O75030; also known as Class E basic helix-loop-helix protein 32, bHLHe32, MITF) is encoded by the MITF (also known as BHLHE32) gene (Gene ID: 4286) in human. MITF is a transcription factor that regulates the expression of genes with essential roles in cell differentiation, proliferation, and survival. It is expressed in kidney and melanocytes. Isoforms C2, H1 and H2 are mainly expressed in kidney and isoforms M1 and Mdel are expressed in melanocytes. Isoforms A2 and C2 are detected in retinal pigment epithelium. It is present in homodimeric or heterodimeric form. Its dimerization is mediated via the coiled coil region (aa 355-402). Its efficient DNA binding requires dimerization with another bHLH protein. It binds to M-boxes (5-TCATGTG-3) and symmetrical DNA sequences (E-boxes) (5-CACGTG-3) found in the promoters of target genes, such as BCL2 and tyrosinase (TYR). MITF plays an important role in melanocyte development by regulating the expression of TYR and tyrosinase-related protein 1 (TYRP1). It also plays a critical role in the differentiation of various cell types, such as neural crest-derived melanocytes, mast cells, osteoclasts, and optic cup-derived retinal pigment epithelium. It can undergo phosphorylation at serine 405, which enhances its ability to bind the tyrosinase promoter. Its phosphorylation at serine 180 and serine 516 following KIT signaling, trigger a short-lived activation. These phosphorylations by MAPK and RPS6KA1, respectively, activate the transcription factor activity, but also promote ubiquitination and subsequent degradation by the proteasome. Mutations in MITF gene have been linked to cutaneous malignant melanoma and Waardenburg syndrome 2A, which is characterized by sensorineural deafness and pigmentary disturbances. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

expressed in HEK 293 cells

antibody form

purified antibody

antibody product type

primary antibodies

clone

1E2, recombinant monoclonal

description

recombinant, expressed in HEK 293 cells

calculated mol wt 58.80 kDa","observed mol wt ~58 kDa

antibody small pack of 25 µL

enhanced validation

recombinant expression

application(s)

affinity binding assay: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 2D19 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Mitofusin-2. It targets an epitope within 21 amino acids from the cytoplasmic domain in the C-terminal half.

Anti-Mitofusin-2 Antibody, clone 2D19 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 21 amino acids from the first cytoplasmic domain in the C-terminal region of human Mitofusin-2.

Quality Control Testing
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected Mitofusin-2 in HeLa cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected Mitofusin-2 in U2OS, COS-7, and PC12 cell lysates.
Immunocytochemistry Analysis: A 1:100 dilution from a representative detected Mitofusin-2 in HeLa cells.
Affinity Binding Assay: A representative lot of this antibody bound Mitofusin-2 peptides with a KD of 1.4 x 10-7 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-Mitofusin-2, clone 2D19 ZooMAb®, Cat. No. ZRB1202, is a recombinant Rabbit monoclonal antibody that specifically targets Mitofusin-2 and is tested for use in Affinity Binding Assay, Immunocytochemistry, and Western Blotting.
Target description
Mitofusin-2 (UniProt: O95140; also known as Transmembrane GTPase MFN2) is encoded by the MFN2 (also known as CPRP1, KIAA0214) gene (Gene ID: 9927) in human. Mitofusin-1 and 2 are highly homologous mitochondrial proteins that display ~80% similarity in humans. Mitofusin-2 is a multi-pass membrane protein that serves as a mitochondrial outer membrane GTPase to mediate mitochondrial clustering and fusion. It is ubiquitously expressed at low level, but higher expression is observed in heart and kidney. It consists of a large, cytoplasmic N-terminal GTPase domain, followed by a spacer, a first coiled-coil heptad-repeat (HR1) domain, a spacer, two transmembrane domains that cross the outer mitochondrial membrane, a spacer and a second, C-terminal heptad-repeat domain (HR2). Between HR1 and transmembrane domains, it contains a proline-rich domain that participates in protein protein interactions. Mitofusin-2 plays a key role in mitochondrial metabolism and is involved in mitochondrial fusion, trafficking, turnover, contacts with other organelles, and in the clearance of damaged mitochondria via selective mitophagy. Mitofusin-2 is phosphorylated by PINK1 and the phosphorylated form functions as a receptor for parkin that mediates its ubiquitination, a signal to mark damaged mitochondria. It is also required in the control of unfolded protein response upon endoplasmic reticulum stress. Mitofusion-2 knockout cells display mitochondrial spheres or ovals of different sizes and are several folds larger in diameter than wild-type. Mutations in MFN2 gene are known to cause Charcot-Marie-Tooth disease that is characterized by signs of axonal degeneration and progressive distal muscle weakness and atrophy. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Filadi, R., et al. (2018). Cell Death Dis. 9; Article 330).
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit
Quality Level	200,
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	2D19, monoclonal, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt ~ 86.4 kDa, observed mol wt ~ 79 kDa
species reactivity	rat, human, monkey
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	affinity binding assay: suitable, immunocytochemistry: suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MKI67 antibody produced in rabbit

HPA000451 Human Protein Atlas characterization data

Antigen KI-67 recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Western Blotting (1 paper),
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST79727,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	PAKVEDAADSATKPENLSSKTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLPGLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIK
conjugate	unconjugated
UniProt accession no.	P46013,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MKI67(4288)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Anti-MKI67IP antibody produced in rabbit

HPA035735 Human Protein Atlas characterization data

nucleolar protein interacting with the FHA domain of MKI67

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88687,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	RNAi knockdown
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500","western blot: 0.04-0.4 µg/mL
isotype	IgG
immunogen sequence	IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
conjugate	unconjugated
UniProt accession no.	Q9BYG3,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NIFK(84365)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MKKS antibody produced in rabbit HPA041071-100UL

HPA041071 Human Protein Atlas characterization data

McKusick-Kaufman syndrome recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST83100,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	independent
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	ALESVVGSLEHDGGEILTDMKYGHLWSVQADSPCVANWPDLLSQCGCGLYNSQEELNWSFLRSTRRPFVPQSCLPHEAVGSASNLTL
conjugate	unconjugated
UniProt accession no.	Q9NPJ1,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MKKS(8195)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MKL1 antibody produced in rabbit

HPA030782 Human Protein Atlas characterization data

The gene MKL1 (megakaryoblastic leukemia (translocation) 1) is mapped to human chromosome 22q13.2. It belongs to the myocardin-related family of transcriptional coactivators. The protein is present in the cytoplasm and nucleus. It is widely expressed in human tissues.

megakaryoblastic leukemia (translocation) 1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Anti-MKL1 antibody produced in rabbit has been used in immunofluorescence.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper),
Biochem/physiol Actions
MKL1 (megakaryoblastic leukemia (translocation) 1) is a transcriptional coactivator. G-actin interacts with MKL1 and prevents its association with transcription factor SRF (serum response factor). Release of MKL1 from G-actin results in an interaction between SRF and MKL1. This association controls the expression of cytoskeletal proteins. MKL1 is also involved in skeletal, cardiac and smooth muscle differentiation. It also enhances tumor cell invasion and metastasis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73615,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq RNAi knockdown
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG
conjugate	unconjugated
UniProt accession no.	Q969V6,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MKL1(57591)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MKNK2 antibody produced in rabbit

HPA021875 Human Protein Atlas characterization data

MKNK2 (MAP kinase interacting serine/threonine kinase 2) is a serine threonine kinase belonging to the human MAP kinase-interacting kinases group. It consists of a zinc-binding domain and an atypical open conformation region.

MAP kinase-interacting serine/threonine-protein kinase 2 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MKNK2 (MAP kinase interacting serine/threonine kinase 2) is associated with various MAPK-dependent growth factor signaling pathways. It acts in downstream kinase activated by mitogen-activated protein (MAP) kinases in response to mitogens and stress. MKNK2 phosphorylates the cap binding eukaryotic initiation factor 4E (eIF4E) at Ser-209 position during the initiation of mRNA translation, oncogenic transformation and malignant cell proliferation. Studies show it may negatively control arsenic trioxide-dependent apoptosis and antileukemic responses.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73483,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	ELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQE
conjugate	unconjugated
UniProt accession no.	Q9HBH9,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MKNK2(2872)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MKRN2 antibody produced in rabbit

HPA037560 Human Protein Atlas characterization data

Makorin ring finger protein 2 (MKRN2) belongs to makorin RING (Really Interesting New Gene) zinc-finger family and is a 42 kDa ribonucleoprotein. It has zinc finger motifs in N and C-terminus. MKRN2 is mapped to human chromosome 3p25.2.

makorin ring finger protein 2 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MKRN2 gene locus duplication is observed in heart disorder, tetralogy of fallot and in congenital disorder, Noonan syndrome. MKRN2 interacts with PDZ (postsynaptic density protein (PSD95), drosophila disc large tumor suppressor (Dlg1), and zonula occludens-1 protein (zo-1))-LIM domain-containing protein (PDLIM2) and mediates degradation of p65. MKRN2 is highly expressed in myelogenous leukemia cell line, K562 and promotes cell proliferation and leukemogenesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST79311,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESS
conjugate	unconjugated
UniProt accession no.	Q9H000,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MKRN2(23609)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MKS1 antibody produced in rabbit

HPA021372 Human Protein Atlas characterization data

The gene MKS1 (meckel syndrome type 1) is mapped to human chromosome 17q23. The protein localizes to centrosomes.

Meckel syndrome type 1 protein recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MKS1 (meckel syndrome type 1) interacts with meckelin and they are important for primary cilium formation and basal body function. Mutations in MKS1 are linked with Meckel-Gruber syndrome, a lethal malformation syndrome with renal cystic dysplasia, central nervous system abnormalities and hepatic developmental problems.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST75584,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human, rat
packaging	antibody small pack of 25 µL
enhanced validation	independent
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	EVPSFLVERMANVRRRRQDRRGMEGGILKSRIVTWEPSEEFVRNNHVINTPLQTMHIMADLGPYKKLGYKKYEHVLCTLKVDSNGVITVKPDFTGLKGPYRI
conjugate	unconjugated
UniProt accession no.	Q9NXB0,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MKS1(54903)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MLANA antibody produced in rabbit

HPA048662 Human Protein Atlas characterization data

Melanoma-associated antigen recognized by T cells-1 (MART-1) (also known as Melan-A) is a melanocyte differentiation antigen recognized by autologous cytotoxic T lymphocytes. It is a transmembrane protein which is hydrophobic in nature. Six other melanoma associated antigens recognized by autologous cytotoxic T cells include MAGE-1, Tyrosinase, gp100, gp75, BAGE-1, and GAGE-1. Subcellular fractionation shows that MART-1 is present in melanosomes and endoplasmic reticulum. The protein is also expressed in melanoma tumors.

melan-A

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Melanoma-associated antigen recognized by T cells-1 (MART-1) has been shown to be essential for the functioning of glycoprotein-100 (gp100).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST81897,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:1000-1:2500
immunogen sequence	RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
conjugate	unconjugated
Featured Industry	Research Pathology
UniProt accession no.	Q16655,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MLANA(2315)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MLC1 antibody produced in rabbit

HPA067533 Human Protein Atlas characterization data

megalencephalic leukoencephalopathy with subcortical cysts 1

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88214,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI
conjugate	unconjugated
UniProt accession no.	Q15049,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MLC1(23209)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MLF2 antibody produced in rabbit

HPA010811 Human Protein Atlas characterization data

MLF2 (myeloid leukemia factor 2) is a 248 amino acid protein, which shares high similarity with MLF1 protein. This gene is localized to human chromosome 12p13, and has an open reading frame of 744bp. MLF2 mRNA is ubiquitously expressed.

Myeloid leukemia factor 2 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MLF2 (myeloid leukemia factor 2) plays a role in the self-renewal of breast cancer stem cells (BCSCs). Mutations in this gene that lead to gain-of-function, is found in lung metastases in patients with both estrogen receptor (ER)+ and ER- breast cancer. It regulates nitric oxide synthase signaling, and its expression level is affected by hypoxia. MLF2 therefore, plays a role in breast cancer tumorigenesis and lung metastasis. In chickens, this gene is associated with coccidiosis resistance.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71688,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQA
conjugate	unconjugated
UniProt accession no.	Q15773,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MLF2(8079)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 3F13 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Mixed lineage kinase domain-like protein (MLKL). It targets an epitope within 16 amino acids from the N-terminal region.

Anti-MLKL Antibody, clone 3F13, ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 16 amino acids from the N-terminal region of murine Mixed lineage kinase domain-like protein (MLKL).

Anti-MLKL, clone 3F13 ZooMAb , Cat. No. ZRB1142, is a recombinant rabbit monoclonal antibody that specifically targets Mixed lineage kinase domain-like protein (MLKL) and has been tested for use in Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected MLKL in C2C12 cell lysate.
Immunofluorescence Analysis: A 1:100 dilution from a representative lot detected MLKL in rat kidney tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected MLKL in mouse kidney and rat kidney tissue sections.
Note: Actual optimal working dilutions must be determined by the end user as specimens and experimental conditions may vary.
Target description
Mixed lineage kinase domain-like protein (UniProt: Q9D2Y4; also known as MLKL) is encoded by the Mlkl gene (Gene ID: 74568) in murine species. MLKL is a pseudokinase that plays a key role in TNF-induced necroptosis. MLKL is highly expressed in thymus, colon, intestine, liver, spleen and lung and is expressed at much lower level in skeletal muscle, heart and kidney. It is not detected in brain. MLKL is activated following phosphorylation by RIPK3 that induces a conformational switch, which is essential for necroptosis. The protein kinase domain of MLKL is catalytically inactive but contains a pseudoactive site with an interaction between Lys-219 and Gln-343 residues. Upon phosphorylation by RIPK3, MLKL undergoes an active conformation and homotrimerization through its amino-terminal coiled-coil domain. Phosphorylation is also essential for homotrimerization of MLKL and its subsequent localization to the plasma membrane. Plasma membrane localization of MLKL is considered to be essential for Ca2+ influx, which is an early event of TNF-induced necroptosis. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Cai, Z et al. (2014). Nat. Cell Biol. 16(1): 55-65).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose. Normal appearance is a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	3F13, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt 54.32 kDa, observed mol wt ~54 kDa
species reactivity	mouse, rat
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency Learn more about the Principles of Green Chemistry,.
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable (peptide)
isotype	IgG
conjugate	unconjugated
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

ZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 5C15 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects Histone-lysine N-methyltransferase 2A (MLL/HRX). It targets an epitope within 21 amino acids from the MLL cleavage product C180 region.

Anti-MLL/HRX CT Antibody, clone 5C15 ZooMAb® Rabbit Monoclonal

KLH-conjugated linear peptide corresponding to 21 amino acids from the p180 C-terminal subunit of human Histone-lysine N-methyltransferase 2A (MLL/HRX).

Quality Control Testing
Evaluated by Immunohistochemistry (Paraffin) in human kidney tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution of this antibody detected MLL/HRX in human kidney tissue sections.
Tested Applications
Affinity Binding Assay: A representative lot of this antibody bound MLL peptides with a KD of 1.2 x 10-6 in an affinity binding assay.
Immunocytochemistry Analysis: A 1:100 dilution from representative lot detected MLL/HRX CT in HeLa and A431 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-MLL/HRX CT, clone 5C15 ZooMAb®, Cat. No. ZRB1061, is a recombinant Rabbit monoclonal antibody that specifically targets MLL/HRX and is tested for use in Affinity Binding Assay, Immunocytochemistry, and Immunohistochemistry (Paraffin).
Target description
Histone-lysine N-methyltransferase 2A (UniProt: Q03164; also known as EC:2.1.1.354, Lysine N-methyltransferase 2A, ALL-1, CXXC-type zinc finger protein 7, Myeloid/lymphoid or mixed-lineage leukemia, Myeloid/lymphoid or mixed-lineage leukemia protein 1, MLL, Trithorax-like protein, Zinc finger protein HRX) is encoded by the KMT2A (also known as ALL1, CXXC7, HRX, HTRX, MLL, MLL1, TRX1) gene (Gene ID: 4297) in human. MLL is a histone methyltransferase that plays an essential role in early development and hematopoiesis. It is expressed in heart, lung, brain, and in T and B lymphocytes. Catalytic subunit of the MLL complex mediates both methylation of lysine 4 of histone H3 (H3K4me) complex and acetylation of lysine 16 of histone H4 (H4K16ac). By itself it has weak methyltransferase activity and requires another component of the MLL complex to obtain full methyltransferase activity. MLL does not display any activity towards histone H3 phosphorylated on threonine 3 and has less activity towards histone H3 dimethylated on arginine 8 and lysine 9. However, it displays high activity towards histone H3 acetylated on lysine 9. MLL is normally cleaved into a N-terminal p320 and a C-terminal p180 cleavage product. This cleavage is brought about by taspase 1 (TASP1) at cleavage site 1 (aa 2666-2667) and cleavage site 2 (aa 2718-2719). The p320 and p180 units can heterodimerize via SET and FYRC domains. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit
Quality Level	200,
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	5C15, monoclonal, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt ~ 431.76 kDa
species reactivity	human
species reactivity (predicted by homology)	monkey
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	affinity binding assay: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
isotype	IgG
conjugate	unconjugated
shipped in	ambient
storage temp.	2-8°C

Anti-MLLT3 antibody produced in rabbit

HPA001824 Human Protein Atlas characterization data

Protein AF-9 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
MLLT3 (myeloid/lymphoid or mixed-lineage leukemia; translocated to, 3) is associated with super elongation complex (SEC) to stimulate catalysis of RNA polymerase II transcription elongation at different regions of the DNA. This further induces oncogenic transformation. It act as a candidate regulator of erythroid/megakaryocytic (E/Meg) lineage mechanism.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86231,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	RNAi knockdown
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	SSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLR
conjugate	unconjugated
UniProt accession no.	P42568,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MLLT3(4300)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MLN antibody produced in rabbit

HPA069392 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88777,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:1000- 1:2500
isotype	IgG
immunogen sequence	AFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEEN
conjugate	unconjugated
UniProt accession no.	P12872,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MLN(4295)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-MMACHC antibody produced in rabbit HPA027402-100UL

HPA027402 Human Protein Atlas characterization data

methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST76748,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	EIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPT
conjugate	unconjugated
UniProt accession no.	Q9Y4U1,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... MMACHC(25974)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable