Protein Biology

KLH-conjugated linear peptide corresponding to 16 amino acids from the internal region of human p105 subunit of NF-kB (C-terminal half of p50 subunit).

Anti-NF-kB p50/105, clone 1N19 ZooMAb, Cat. No. ZRB2082, is a recombinant Rabbit Monoclonal Antibody that specifically targets Nuclear factor NF-kappa-B p105 subunit and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected NF-kB p50/105 in NIH3T3, A431, and Raji cell lysates.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected NF-kB p50/105 in human tonsil, human prostate cancer and mouse spleen tissue sections.
Immunocytochemistry Analysis: A 1:1,000 dilution from a representative lot detected NF-kB p50/105 in HeLa cells.
Target description
Nuclear factor NF-kappa-B p105 subunit (UniProt: P19838; also known as DNA-binding factor KBF1, EBP-1, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1) is encoded by the NFKB1 gene (Gene ID: 4790) in human. NF- B family of transcription factors consists of five members in mammalian cells: NF-kB1 (p50/p105), NF-kB2 (p52/p100), RelA (p65), RelB, and c-Rel that associate to form various homodimeric or heterodimeric combinations. All members of NF-kB family share a highly conserved Rel homology domain (RHD), which is responsible for DNA binding, dimerization, and interaction with IkBs. The p50/RelA (p65) heterodimer is the major NF-kB complex in most cells. The p50 subunit of NF-kB (aa 1-433) is synthesized as a precursor molecule of 105 kDa (p105) (aa 1-968) and the subsequent processing of p105 releases the N-terminal p50 subunit that contains the Rel homology domain. The p50 subunit binds to the kappa-B consensus sequence 5′-GGRNNYYCC-3′, located in the enhancer region of genes involved in immune response and acute phase reactions. The carboxy-terminal region of p105 contains seven copies of an ankyrin-related sequence. The activity of NF-kB is tightly regulated by its interaction with inhibitory IkB proteins, which in most resting cells sequesters NF-kB in the cytoplasm in an inactive form. Unlike normal cells, in most cancer cells NF-kB is constitutively active and resides in the nucleus. Several key processes, such as self-sufficiency in growth signals, insensitivity to growth inhibitors, evading apoptosis, unlimited replicative potential, tissue invasion, and sustained angiogenesis, are all enhanced following NF-kB activation. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Liou, HC et al., (1992). EMBO J. 11(8); 3003 3009; Yu, Y., et al. (2009). Curr. Cancer Drug Targets 9(4); 566-571).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

ZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	1N19, monoclonal","recombinant monoclonal
product line	ZooMAb^®
form	lyophilized
mol wt	calculated mol wt 105.37 kDa","observed mol wt ~50 and 105 kDa
species reactivity	human, mouse
species reactivity (predicted by homology)	rat
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency.
enhanced validation	recombinant expression
application(s)	immunocytochemistry: 1:100-1:1,000","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable using 1:100","western blot: suitable using 1:1,000
isotype	IgG
conjugate	unconjugated
UniProt accession no.	P19838,
shipped in	ambient
storage temp.	2-8°C
Gene Information	human ... NFKB1(4790)

ZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Узнать цену

Подробнее

Anti-NF-kB p65 subunit Antibody, clone 1D8 ZooMAb® Rabbit Monoclonal

Specificity

Clone 1D8 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects p65. It targets an epitope within 20 amino acids from the C-terminal region.

KLH-conjugated linear peptide corresponding to 20 amino acids from the C-terminal region of human NF-kB p65 subunit.

Anti-NF-kB p65 subunit, clone 1D8 ZooMAb®, Cat. No. ZRB1498, is a recombinant Rabbit monoclonal antibody that detects NF-kB p65 subunit and is tested for use in Affinity Binding Assay, Immunohistochemistry (Paraffin), and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in K562 cell lysate.
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected NF-kB p65 subunit in K562 cell lysate.
Tested applications
Western Blotting Analysis: A 1:10,000 dilution from a representative lot detected NF-kB p65 subunit in NIH3T3 cell lysate.
Affinity Binding Assay: A representative lot of this antibody bound NF-kB p65 peptide with a KD of 1 x 10-12 in an affinity binding assay.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected NF-kB p65 subunit in human placenta tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Transcription factor p65 (UniProt: Q04206; also known as Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, NF-kB p65) is encoded by the RELA (also known as NFKB3) gene (Gene ID: 5970) in human. NF-kB is a pleiotropic transcription factor that is present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. Five members of NF-kB family have been described in mammalian cells: NF- B1 (p50/p105), NF- B2 (p52/p100), RelA (p65), RelB, and c-Rel that associate to form various homodimeric or heterodimeric combinations. They share a highly conserved Rel homology domain (RHD), which is responsible for DNA binding, dimerization, and interaction with IkBs. The p50/RelA (p65) heterodimer is the major NF- B complex in most cells. The activity of NF- B is tightly regulated by its interaction with inhibitory I B proteins. In most resting cells, NF- B is sequestered in the cytoplasm in an inactive form associated with inhibitory molecules such as I B , I B, I B , p105, and p100. This interaction blocks the ability of NF- B to translocate to the nucleus and bind to DNA. Following exposure to proinflammatory cytokines, UV light, reactive oxygen species, or bacterial and viral toxins, the NF- B signaling cascade is activated, leading to the proteasomal degradation of I B. This allows the translocation of unmasked NF- B from the cytoplasm to the nucleus where it binds to NF- B response elements in target genes and regulates their transcription. In a conventional activation pathway, IkB is phosphorylated by I B kinases (IKKs) and degraded thereby liberating NF- B to translocate to the nucleus. The inhibitory effect of IkB on NF- B through retention in the cytoplasm is exerted primarily through the interaction with RelA (p65). Beside its activity as a direct transcriptional activator, p65 can also modulate promoters accessibility to transcription factors and thereby indirectly regulate gene expression. RelA (p65) undergoes phosphorylation at Ser 536, which stimulates acetylation on Lys 310 and interaction with CBP. This phosphorylated and acetylated form of p65 displays enhanced transcriptional activity. Although acetylation at Lys 122 can enhance its DNA binding activity, but acetylation at Lys 310 is required for its full transcriptional activity. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

expressed in HEK 293 cells

antibody form

purified antibody

antibody product type

primary antibodies

clone

1D8, recombinant monoclonal

description

recombinant, expressed in HEK 293 cells

calculated mol wt 60.22 kDa","observed mol wt ~65 kDa

species reactivity

mouse, human

species reactivity (predicted by homology)

bovine, monkey, canine, rat

packaging

NF2 is a tumor suppressor present in the nucleus and membranes of cells. NF2 modulates mitotic inhibition, and also regulates the adhesion and polarity of epithelial cells. Additionally, this protein facilitates contact inhibition . Anti-NF2 antibody is specific for NF2 in humans.

Anti-NF2 antibody produced in rabbit

MDL number:	MFCD01633914
Human Protein Atlas Number:	HPA003097 Human Protein Atlas characterization data

Merlin recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper),
These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Anti-NF2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,. Anti-NF2 antibody is also suitable for use in indirect immunofluorescence assays.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73592,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	rat, human, mouse
packaging	antibody small pack of 25 µL
enhanced validation	RNAi knockdown
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVA
conjugate	unconjugated
UniProt accession no.	P35240,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NF2(4771)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Anti-NFAM1 antibody produced in rabbit

HPA031812 Human Protein Atlas characterization data

The gene NFAM1 (NFAT activation molecule 1) is mapped to human chromosome 22q13. It is mainly expressed in spleen B and T cells. The encoded protein has a signal peptide, a transmembrane region and an immunoglobulin domain in the extracellular region.

NFAT activating protein with ITAM motif 1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NFAM1 (NFAT activation molecule 1) controls B cell signaling and development via ITAM (immunoreceptor tyrosine-based activation motif). It participates in the activation of the calcineurin/NFAT (nuclear factor of activated T-cells)-signaling pathway and thus controls downstream cytokine gene promoters. In Paget′s disease of bone, NFAM1 is associated with osteoclast formation and bone resorption activity. It controls intracellular calcium levels, PLCγ (phospholipase C), expression of calcineurin and activation of Syk (tyrosine kinase).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST78203,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	NKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYE
conjugate	unconjugated
UniProt accession no.	Q8NET5,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFAM1(150372)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NFASC antibody produced in rabbit

HPA008832 Human Protein Atlas characterization data

NFASC (neurofascin) is a member of the L1 family of CAMs (cell adhesion molecules), which in turn is a part of the immunoglobulin (Ig) superfamily of proteins. It is mainly expressed in the nervous system. The members of L1 family contain six Ig-like domains and four to five Fn (fibronectin) domains in their extracellular region. Their cytoplasmic domain contains a putative conserved motif (FIG(Q/A)Y) that links the proteins to cytoplasm and also facilitates the binding to ankyrin. This protein has multiple spliced isoforms, with two major isoforms called NF155 of 155kDa and NF186 of 186kDa. These isoforms are expressed in the glia and axons respectively.

Neurofascin precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
The NF155 isoform of NFASC (neurofascin) acts as the ligand for CNTN1/CASPR1 (contactin 1/ contactin-associated protein 1) complex at the paranode of glia, where it plays an essential role in myelination and the functional assembly of node of Ranvier. Inactivation of this isoform in mice results in severe demyelinating neuropathy, with highly decreased conduction velocities. It is also accompanied with degeneration of Purkinje neurons, which results in ataxia and prominent tremor. Autoantibodies to this protein are linked to a subtype of chronic inflammatory demyelinating polyradiculoneuropathy (CIDP). Studies show that antibodies against NFASC result in accumulation of complement proteins, axonal injury and the exacerbation of multiple sclerosis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71582,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:50- 1:200
immunogen sequence	LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFE
conjugate	unconjugated
UniProt accession no.	O94856,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFASC(23114)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

NFATC2 (nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2) is a member of the nuclear factor family called NFAT. It is expressed in peripheral T-cells, as well as cells not belonging to the immune system. It is a heavily phosphorylated protein. It was first recognized as a regulator of transcription, influencing the proliferation and migration of T-cells.

Anti-NFATC2 antibody produced in rabbit

MDL number:	MFCD02263821
Human Protein Atlas Number:	HPA008789 Human Protein Atlas characterization data

Nuclear factor of activated T-cells, cytoplasmic 2 recombinant protein epitope signature tag (PrEST)

Anti-NFATC2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Western Blotting (1 paper),
Biochem/physiol Actions
NFATC2 (nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2) is dephosphorylated and induced by calcineurin, which is a phosphatase. It is up-regulated in glioblastoma multiforme (GBM), where it leads to elevated expression of interleukin-13 receptor α2subunit (IL-13Rα2). In GBM, this protein facilitates the invasiveness of the tumor by activating multiple invasion-promoting genes, such as matrix metalloproteinase-7 (MMP7), MMP9 and COX2 (cyclooxygenase 2). This protein is constitutively expressed in melanoma, and its expression is suppressed on treatment with cyclosporin A, which results in death of neoplastic cells. Thus, this protein has potential as a therapeutic target in melanoma.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70871,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	DFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPV
conjugate	unconjugated
UniProt accession no.	Q13469,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFATC2(4773)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NFE2 antibody produced in rabbit

HPA001914 Human Protein Atlas characterization data

Nuclear factor erythroid 2 (NFE2) is a transcription factor, involved with the regulation of erythroid and megakaryocytic lineage-specific genes. It is a basic leucine zipper (bZIP) heterodimer with two different sized subunit: hematopoietic-specific larger p45 polypeptide belongs to the cap and collar (CNC) family and widely expressed smaller subunit MafG from the p18/Maf K family.

Transcription factor NF-E2 45 kDa subunit recombinant protein epitope signature tag (PrEST)

Anti-NFE2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NFE2 (nuclear factor, erythroid 2) is involved in regulation of transcription by two means: by modifying chromatin structure and by modulating transcription factor activity. Two domains, p45 and MafG (transcription factor), dimerize to form a composite DNA binding domain. NFE2 positively regulates transcription by binding to a class of specific DNA sequences of erythroid and megakaryocytic genes. Specifically, amino terminal of p45 exerts activator function when binds to several proteins, including the general transcription factor TAFII130 (transcription initiation factor TFIID 130kDa subunit). It has also been reported that sumoylation of p45 enhances the DNA binding affinity of NFE2 which further increase the transactivation capability of NFE2.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84758,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES
conjugate	unconjugated
UniProt accession no.	Q16621,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFE2(4778)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NFE2L3 antibody produced in rabbit

HPA055889 Human Protein Atlas characterization data

nuclear factor (erythroid-derived 2)-like 3 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86541,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	LEGISLGDIPLPGSISDGMNSSAHYHVNFSQAISQDVNLHEAILLCPNNTFRRDPTARTSQSQEPFLQLNSHTTNPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYD
conjugate	unconjugated
UniProt accession no.	Q9Y4A8,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFE2L3(9603)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NFIA antibody produced in rabbit

HPA006111 Human Protein Atlas characterization data

Nuclear factor 1 A-type recombinant protein epitope signature tag (PrEST)
Sequence
LKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQ

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70957,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	rat, mouse, human
packaging	antibody small pack of 25 µL
enhanced validation	independent orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
conjugate	unconjugated
UniProt accession no.	Q12857,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFIA(4774)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Nuclear factor NF-kappa-B p105 subunit recombinant protein epitope signature tag (PrEST)

Anti-NFKB1 antibody produced in rabbit

MDL number:	MFCD00802847
Human Protein Atlas Number:	HPA027305 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST83073,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq RNAi knockdown
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
conjugate	unconjugated
UniProt accession no.	P19838,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFKB1(4790)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

KLH-conjugated linear peptide corresponding to 16 amino acids from the N-terminal region of human Nuclear factor NF-kappa-B p100 subunit.

Anti-NFkB2 (p100/p52) Antibody, clone 5F3 ZooMAb® Rabbit Monoclonal

Quality Control Testing
Evaluated by Western Blotting in HeLa cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected NFkB2 (p100/p52) in HeLa cell lysate.
Tested Applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected NFkB2 (p100/p52) in Jurkat and HepG2 cell lysates.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected NFkB2 (p100/p52) in human small intestine and human testis tissue sections.
Affinity Binding Assay: A representative lot of this antibody bound NFkB2 peptide with a KD of 4.5 x 10-8 in an affinity binding assay.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected NFkB2 (p100/p52) in HepG2 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-NFkB2 (p100/p52), clone 5F3 ZooMAb®, Cat. No. ZRB1250, is a recombinant Rabbit monoclonal antibody that targets p100/p52 of NFkB2 and is tested in Affinity Binding Assay, Immunocytochemistry, and Immunohistochemistry (Paraffin), and Western Blotting
Target description
Nuclear factor NF- kB p100 subunit (UniProt: Q00653; also known as DNA-binding factor KBF2, H2TF1, Lymphocyte translocation chromosome 10 protein, Nuclear factor of kappa light polypeptide gene (Gene ID: 4791) in human. NF kB is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. Five members of the NF- kB family have been identified that associate to form various homodimeric or heterodimeric combinations. They share a highly conserved Rel homology domain (RHD), which is responsible for DNA binding, dimerization, and interaction with IkBs. In most resting cells, NF- kB is sequestered in the cytoplasm in an inactive form associated with inhibitory molecules, which blocks the ability of NF- kB to translocate to the nucleus and bind to DNA. In a conventional activation pathway, IkB is phosphorylated and degraded thereby liberating NF- kB to translocate to the nucleus. In a non-canonical activation pathway, CHUK/IKKA homodimer phosphorylates NFkB2/p100 associated with RelB, inducing its proteolytic processing to NFkB2/p52 and the formation of RelB-p52 complex that serves as a transcriptional activator. However, the p52-p52 homodimer acts as a transcriptional repressor. NFkB2 has dual functions such as cytoplasmic retention of attached NF- kB proteins by p100 and generation of p52 by a co-translational processing. p52 is shown to bind to the kB consensus sequence 5-GGRNNYYCC-3, located in the enhancer region of genes involved in immune response and acute phase reactions. Clone 5F3 detects both the p100 and p52 units. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

Nuclear factor-κ−B 2 (nfκb2) is a proto-oncogene mapped to human chromosome 10q24.1. The gene codes for NFκB2 subunit, also referred to as p100-p52, which is a member of NF-κB/Rel family of proteins. The encoded protein is characterized with a DNA-binding rel domain at its N-terminal end, a poly (G) hinge and an ankyrin domain at its C-terminal end. The native nfκb2 gene is localized to cytoplasm whereas the abnormal gene, which lacks IκB-like properties is expressed in nucleus.

biological source	rabbit
Quality Level	200,
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	5F3, monoclonal, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt ~ 96.75 kDa, observed mol wt ~ 110 and 50 kDa
species reactivity	human
species reactivity (predicted by homology)	monkey, bovine
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	affinity binding assay: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
shipped in	ambient
storage temp.	2-8°C

Anti-NFKB2 antibody produced in rabbit HPA023900-100UL

MDL number:	MFCD01322455
Human Protein Atlas Number:	HPA023900 Human Protein Atlas characterization data

General description

Nuclear factor NF-kappa-B p100 subunit recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Nuclear factor --B 2 (NFB2) is the primary protein that takes part in the noncanonical NF-B pathway and it also aids in various cellular functions such as peripheral lymphoid organ development, B cell development, and antibody production. NFB-2 can act as either B-mediated transcription activator or repressor depending on the relative concentration of its dimerization partner in the nucleus.
Aberrations in the C-terminal end of the NFB2 gene contribute to the pathogenesis of various hematopoietic tumors, such as chronic lymphocytic leukemia, multiple myeloma, and cutaneous T-cell lymphoma gene. Mutations in NFB2 lead to a heterogeneous disorder named common variable immunodeficiency (CVID).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86755,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	orthogonal RNAseq independent
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	ICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQP
conjugate	unconjugated
UniProt accession no.	Q00653,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFKB2(4791)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NFKBIZ antibody produced in rabbit

HPA010547 Human Protein Atlas characterization data

NFKBIZ (NFKB inhibitor ξ), also known as IκBξ, is a member of the IκB inhibitor protein family. It is a nuclear protein, and is induced in macrophages and lung primary cells, following TLR/IL-1 (toll like receptor/ interleukin-1) signaling. Two mRNA of this protein is produced through alternate splicing, long and short, where the short form lacks the 99-amino acid sequence at the N-terminal, present in the long form.

NF-kappa-B inhibitor zeta recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NFKBIZ (NFKB inhibitor ζ) functions as an inhibitor of NFκB, and is controlled by it through negative feedback loop. It is also essential for the induction of certain inflammation-related gene such as IL6 (interleukin 6). Studies show that various variants of this gene are linked with susceptibility to invasive pneumococcal disease (IPD) in humans. This gene is regulated by IL1 and interferon (IFN)-γ, which in turn induces β-glucan-activated human dendritic cell programming. It also influences both canonical and non-canonical NF?B signaling in activated B-cell-like (ABC) subtype of diffuse large B-cell lymphoma (DLBCL).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71497,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:50- 1:200
immunogen sequence	QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL
conjugate	unconjugated
UniProt accession no.	Q9BYH8,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFKBIZ(64332)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NFS1 antibody produced in rabbit

HPA051801 Human Protein Atlas characterization data

NFS1 cysteine desulfurase

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST87597,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF
conjugate	unconjugated
UniProt accession no.	Q9Y697,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NFS1(9054)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

HEK293 cells expressing a truncated integral membrane form of NG2 corresponding to amino acids 1592-2222.

Anti-NG2 Antibody, clone 132.38 ZooMAb® Mouse Monoclonal

Anti-NG2, clone 132.38 ZooMAb, Cat. No. ZMS1037, is a recombinant Mouse monoclonal antibody that specifically targets NG2 protein and is tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Immunocytochemistry Analysis: A 1:1,000 dilution from a representative lot detected NG2 in Oligodendrocytes.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected NG2 in rat brain tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Chondroitin sulfate proteoglycan 4 (UniProt: Q00657; also known as Chondroitin sulfate proteoglycan NG2, HSN tumor-specific antigen) is encoded by the Cspg4 (also known as Ng2) gene (Gene ID: 81651) in rat. Chondroitin sulfate proteoglycan NG2 is a single-pass type I membrane protein that plays a role in cell proliferation and migration and stimulates endothelial cells motility during microvascular morphogenesis. It is present in neural cells and in extraneural tissues, especially in the developing mesenchyme. Its level of expression is highest on immature, proliferating cells and decreases when these cells begin to differentiate. It is found on the surfaces of an unusual class of glial cells within the developing and mature central nervous system that have the properties of oligodendrocyte precursor cells. It is a major chondroitin sulfate proteoglycan that is produced after spinal cord injury and is expressed by macrophages and oligodendrocyte progenitors. It is also reported to inhibit neurite outgrowth and growth cone collapse during axon regeneration. NG2 chondroitin sulfate proteoglycan is synthesized with a signal peptide (aa 1-29), which is subsequently cleaved off in the mature form. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Jones, LL et al. (2002). J. Neurosci. 22(7):2792-2803).
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

Quality Level	200,
biological source	mouse
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	132.38, monoclonal, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt 251.91 kDa, observed mol wt ~300 kDa
species reactivity	rat
species reactivity (predicted by homology)	mouse
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency Learn more about the Principles of Green Chemistry,.
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable
conjugate	unconjugated
greener alternative category	Aligned,
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Clone 1L2 is a ZooMab rabbit recombinant monoclonal antibody that specifically detects Chondroitin sulfate proteoglycan 4 (NG2).

Anti-NG2 Antibody, clone 1L2, ZooMAb® Rabbit Monoclonal

Recombinant extracellular domain of rat Chondroitin sulfate proteoglycan 4 (NG2).

Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected NG2 in C6 cells.
Immunofluorescence Analysis: A 1:100 dilution representative lot detected NG2 in rat brain tissue sections.
Anti-NG2, clone 1L2 ZooMAb, Cat. No. ZRB5320, is a recombinant Rabbit Monoclonal Antibody that specifically targets Chondroitin sulfate proteoglycan 4 (NG2) and has been tested for use in Immunocytochemistry, Immunofluorescence, and Western Blotting.
Target description
Chondroitin sulfate proteoglycan 4 (UniProt: Q00657; also known as Chondroitin sulfate proteoglycan NG2, HSN tumor-specific antigen) is encoded by the Cspg4 (also known as Ng2) gene (Gene ID: 81651) in rat. Chondroitin sulfate proteoglycan NG2 is a single-pass type I membrane protein that plays a role in cell proliferation and migration and stimulates endothelial cells motility during microvascular morphogenesis. It is present in neural cells and in extraneural tissues, especially in the developing mesenchyme. Its level of expression is highest on immature, proliferating cells and decreases when these cells begin to differentiate. It is found on the surfaces of an unusual class of glial cells within the developing and mature central nervous system that have the properties of oligodendrocyte precursor cells. It is a major chondroitin sulfate proteoglycan that is produced after spinal cord injury and is expressed by macrophages and oligodendrocyte progenitors. It is also reported to inhibit neurite outgrowth and growth cone collapse during axon regeneration. NG2 chondroitin sulfate proteoglycan is synthesized with a signal peptide (aa 1-29), which is subsequently cleaved off in the mature form. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Jones, LL et al. (2002). J. Neurosci. 22(7):2792-2803).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
120 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	1L2, monoclonal","recombinant monoclonal
product line	ZooMAb^®
form	lyophilized
mol wt	calculated mol wt 251.91 kDa","observed mol wt ~270 kDa
species reactivity	mouse, rat
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency.
enhanced validation	recombinant expression
application(s)	immunocytochemistry: suitable using 1:100","immunofluorescence: suitable using 1:100","western blot: suitable using 1:1,000
isotype	IgG
conjugate	unconjugated
UniProt accession no.	Q00657,
shipped in	ambient
storage temp.	2-8°C
Gene Information	rat ... Cspg4;Ng2(81651)

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NGB antibody produced in rabbit

HPA042615 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88871,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:20- 1:50
isotype	IgG
immunogen sequence	PEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAA
conjugate	unconjugated
UniProt accession no.	Q9NPG2,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NGB(58157)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

NGFR (nerve growth factor receptor) is a cell surface transmembrane glycoprotein. It belongs to the low-affinity neurotrophin receptor and tumor necrosis factor receptor superfamily. It is expressed on the surface of glial fibrillary acidic protein δ (GFAPδ) cells of the human brain. In addition to the brain, it is also expressed in liver, lung, and muscle cells.

Anti-NGFR antibody produced in rabbit

MDL number:	MFCD00282384
Human Protein Atlas Number:	HPA004765 Human Protein Atlas characterization data

Tumor necrosis factor receptor superfamily member 16 precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NGFR (nerve growth factor receptor) plays a crucial role in the neuronal survival, differentiation and development of neurons in adult brain. It has been reported that the membrane-spanning region and cytoplasmic domain of NGFR plays an essential role in signal transduction during neuronal differentiation. In CNS and peripheral tissues, NGFR acts as a clock gene and its activity is modulated by helix-loop-helix transcription factors: CLOCK and BMAL1.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70014,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000
immunogen sequence	NKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSES
conjugate	unconjugated
UniProt accession no.	P08138,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NGFR(4804)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Anti-NHLH1 antibody produced in rabbit HPA017943-100UL

HPA017943 Human Protein Atlas characterization data

General description

Nescient helix loop helix 1 (NHLH1) is a transcription factor which is expressed in the nervous system during neural tube formation. It is present in the sub ependymal layer of the neuroepithelium and the gene encoding it is localized to human chromosome 1.

nescient helix loop helix 1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Nescient helix loop helix 1 (NHLH1) is involved in regulating activities during neurogenesis and differentiation. It interacts with LIM only (LMO) proteins like LMO1 and LMO2. Studies have shown that NHLH1 is associated with the etiology of neuropsychiatric disorders.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74517,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	recombinant expression
application(s)	immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: 0.04-0.4 µg/mL
immunogen sequence	MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREE
conjugate	unconjugated
UniProt accession no.	Q02575,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NHLH1(4807)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NHP2 antibody produced in rabbit

HPA050400 Human Protein Atlas characterization data

NHP2 ribonucleoprotein

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST87557,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:500-1:1000
immunogen sequence	IKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGE
conjugate	unconjugated
UniProt accession no.	Q9NX24,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NHP2(55651)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Nicastrin (NCSTN) is a type I transmembrane glycoprotein (709 amino acids) that interacts with both presenilin-1 (PS1) and presenilin-2 (PS2). This gene is located on human chromosome 1q23.
Specificity
Rabbit polyclonal anti-Nicastrin recognizes human nicastrin (110 kDa) by immunoblotting. Staining of nicastrin in immunoblotting is specifically inhibited with nicastrin immunizing peptide.

Anti-Nicastrin antibody produced in rabbit N1660-.2ML

MDL number:	MFCD03791914
NACRES:	NA.46

General description

synthetic peptide corresponding to the C-terminus of human nicastrin (amino acids 693-709) conjugated to KLH. The corresponding sequence is identical in mouse.

Anti-Nicastrin antibody produced in rabbit has been used in:

western blotting
immunoprecipitation
co-immunoprecipitation

Biochem/physiol Actions
Nicastrin has a key role in the regulation of presenilin-mediated cleavage of the b-amyloid precursor protein (b-APP) and Notch/GLP-1. Nicastrin binds to the membrane-tethered form of Notch and is essential for the intramembrane cleavage of Notch to generate Notch intracellular domain (NICD), which is involved in intracellular signaling. It has been suggested that nicastrin binds substrates of presenilin/g-secretase complexes or modulates g-secretase activity. Suppression of nicastrin expression in C. elegansembryos induces a subset of notch/glp-1 phenotypes similar to those induced by simultaneous null mutations in both presenilin homologues of C. elegans (sel-12 and hop-1). Thus, increasing evidence indicates that both nicastrin and presenilins are necessary components for the intramembrane proteolysis of proteins such as b-APP and Notch, and implicates a direct role for nicastrin in the pathogenesis of Alzheimers disease and in the regulation of Notch signaling in vivo.
Physical form
Solution in 0.01 M phosphate buffered saline, pH 7.4, containing 15 mM sodium azide.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source	rabbit
Quality Level	200
antibody form	IgG fraction of antiserum
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous solution
mol wt	antigen 110 kDa
species reactivity	rat, mouse, human
enhanced validation	recombinant expression
application(s)	microarray: suitable","western blot: 1:1,000 using minimum working antibody dilution using a whole cell extract of the HEK293 cell line stably transfected with human nicastrin.
conjugate	unconjugated
UniProt accession no.	Q92542,
shipped in	dry ice
storage temp.	20°C
Gene Information	human ... NCSTN(23385)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NID2 antibody produced in rabbit

HPA058772 Human Protein Atlas characterization data

nidogen 2 (osteonidogen)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST89862,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL
immunogen sequence	PGVWAFHIGSTSPLDNVRPAAVGDLSAAHSSVPLGRSFSHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKP
conjugate	unconjugated
UniProt accession no.	Q14112,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NID2(22795)

pictograms	GHS07
signalword	Warning
hcodes	H315 - H319
pcodes	P305 + P351 + P338
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NIF3L1 antibody produced in rabbit

HPA061466 Human Protein Atlas characterization data

NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST87921,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:1000- 1:2500
immunogen sequence	IYSPHTAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNE
conjugate	unconjugated
UniProt accession no.	Q9GZT8,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NIF3L1(60491)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NIN antibody produced in rabbit

HPA005939 Human Protein Atlas characterization data

ninein (GSK3B interacting protein) recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86549,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
conjugate	unconjugated
UniProt accession no.	Q8N4C6,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NIN(51199)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NIP7 antibody produced in rabbit HPA059850-100UL

HPA059850 Human Protein Atlas characterization data

NIP7, nucleolar pre-rRNA processing protein

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST82080,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	ETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYL
conjugate	unconjugated
UniProt accession no.	Q9Y221,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NIP7(51388)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NKAIN4 antibody produced in rabbit HPA029876-100UL

HPA029876 Human Protein Atlas characterization data

Na+/K+ transporting ATPase interacting 4 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72834,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	LKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVY
conjugate	unconjugated
UniProt accession no.	Q8IVV8,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NKAIN4(128414)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Homeobox protein Nkx-2.2 recombinant protein epitope signature tag (PrEST)

Anti-NKX2-2 antibody produced in rabbit

MDL number:	MFCD03097096
Human Protein Atlas Number:	HPA003468 Human Protein Atlas characterization data

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Chromatin immunoprecipitation (1 paper),
Anti-NKX2-2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Homeobox protein Nkx-2.2 is a protein encoded by the NKX2-2 gene in humans. It is a homeodomain-containing transcription factor that plays a critical role in neuroendocrine/glial differentiation. It belongs to a family of genes whose homeodomains are homologous to that of the Drosophila NK-2 gene and may be involved in specifying diencephalic neuromeric boundaries. It serves as an important regulator of growth and development in the ventral forebrain, heart, lung, and thyroid. Its expression has also been detected in the pancreas, where it is vital for the final differentiation of β-cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST84761,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:20-1:50
immunogen sequence	SLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETP
conjugate	unconjugated
UniProt accession no.	O95096,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NKX2-2(4821)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NKX3-1

HPA078571 Human Protein Atlas characterization data

Recombinant protein corresponding to NK3 homeobox 1
Sequence
MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG

Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:200-1:500
conjugate	unconjugated
UniProt accession no.	Q99801,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NKX3-1(4824)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NLGN1 antibody produced in rabbit

HPA006680 Human Protein Atlas characterization data

Neuroligin-1 precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NLGN1 (Neuroligin 1) is a synaptic cell-surface molecule, associated with synaptic activity. It is synthesized by endothelial and vascular smooth muscle cells throughout the vasculature. It facilitates the synapse formation in vitro, for controlling the differentiation of nascent synapses into fully mature nerve terminals. NLGN1 is expressed in the dendrites (postsynaptic) i.e. outside the central nervous system. It is also involved in the insulin secretion. Studies have been reported that its interaction with other neuronal cell surface proteins may play a role in the formation of the sub-membrane insulin secretory apparatus.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70121,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	DQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYS
conjugate	unconjugated
UniProt accession no.	Q8N2Q7,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NLGN1(22871)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NLGN2 antibody produced in rabbit

HPA069278 Human Protein Atlas characterization data

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88409,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:20- 1:50
isotype	IgG
immunogen sequence	PSLHPFGPFPPPPPTATSHNNTLPH
conjugate	unconjugated
UniProt accession no.	Q8NFZ4,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NLGN2(57555)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NLGN3 antibody produced in rabbit

HPA003183 Human Protein Atlas characterization data

Neuroligin-3 precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NLGN3 (neuroligin 3) gene encodes a protein belonging to a family of neuronal cell surface proteins called neuroligins. These are adhesion proteins that bind to a cell surface protein called β-neurexin to form functional synapses. The gene NLGN3 is localized to Xq13 and the encoded protein is localized to excitatory glutamatergic axons. Mutation in this gene may cause intracellular retention of the mutant protein leading to loss of synaptic function. A point mutation in this gene was first observed in two brothers, one with autism and the other with Asperger syndrome.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74444,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTED
conjugate	unconjugated
UniProt accession no.	Q9NZ94,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NLGN3(54413)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NLK antibody produced in rabbit

HPA018192 Human Protein Atlas characterization data

Serine/threonine kinase NLK recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper),
Western Blotting (1 paper),
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73478,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunofluorescence: 0.25-2 µg/mL","western blot: 0.04-0.4 µg/mL
immunogen sequence	LRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPS
conjugate	unconjugated
UniProt accession no.	Q9UBE8,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NLK(51701)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NLRP10 antibody produced in rabbit HPA039498-100UL

HPA039498 Human Protein Atlas characterization data

NLR family, pyrin domain containing 10 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST80791,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	RLLEVKEQEGNDEMTLTMQFLLDISKKDSFSNLELKFCFRISPCLAQDLKHFKEQMESMKHNRTWDLEFSLYEAKIKNLVKGIQMNNVSFKIKHSNEKKSQ
conjugate	unconjugated
UniProt accession no.	Q86W26,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NLRP10(338322)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NLRP11 antibody produced in rabbit

HPA046402 Human Protein Atlas characterization data

NLR family, pyrin domain containing 11 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST82835,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	HLGNDGVAKLLESLISPDCVLKVVGLPLTGLNTQTQQLLMTVKERKPSLIFLSETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSAAMRTSNTASR
conjugate	unconjugated
UniProt accession no.	P59045,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NLRP11(204801)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

KLH-conjugated linear peptide corresponding to 15 amino acids from the N-terminal domain of human NLRP3.

Anti-NLRP3 Antibody, clone 4B4 ZooMAb® Rabbit Monoclonal

Quality Control Testing
Evaluated by Western Blotting in Human Spleen tissue lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected NLRP3 in Human Spleen tissue lysate.Tested Applications
Affinity Binding Assay: A representative lot of this antibody bound NLRP3 peptides with a KD of 1.9 x 10-6 in an affinity binding assay.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected NLRP3 in human tonsil tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected NLRP3 in THP-1 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-NLRP3, clone 4B4 ZooMAb®, Cat. No. ZRB1762, is a recombinant Rabbit monoclonal antibody that specifically targets NLRP3 and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
NACHT, LRR and PYD domains-containing protein 3 (UniProt: Q96P20; also known as Angiotensin/vasopressin receptor AII/AVP-like, Caterpiller protein 1.1, CLR1.1, Cold-induced autoinflammatory syndrome 1 protein, Cryopyrin, PYRIN-containing APAF1-like protein 1, NLRP3) is encoded by the NLRP3 (also known as C1orf7, CIAS1, NALP3, PYPAF1) gene (Gene ID: 114548) in human. NLRP3 serves as the sensor component of the NLRP3 inflammasome and plays a crucial role in innate immunity and inflammation. It is predominantly expressed in macrophages and its expression is also observed in dendritic cells, B- and T-cells, and in lung epithelial cells. NLRP3 can be induced by activators of Toll-like receptors, bacterial lipopolysaccharides, and by TNF. In response to pathogens and other damage-associated signals, it initiates the formation of the inflammasome polymeric complex that is composed of NLRP3, PYCARD and CASP1. Recruitment of proCASP1 to the inflammasome is shown to promote its activation and CASP1-catalyzed IL-1B and IL-18 maturation and secretion in the extracellular milieu. Under resting conditions, NLRP3 is autoinhibited and it is activated in response to several signals, including extracellular ATP, reactive oxygen species, K+ efflux, crystals of monosodium urate or cholesterol, and amyloid-beta fibers. Independently of inflammasome activation, it is reported to regulate the differentiation of T helper 2 (Th2) cells and is shown to play a role in Th2 cell-dependent asthma and tumor growth. NLRP3 undergoes polyubiquitination at lysine 48 and 63. However, this ubiquitination does not lead to its degradation, but inhibits inflammasome activation. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit
Quality Level	200,
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	4B4, monoclonal, recombinant monoclonal
product line	ZooMAb^® learn more,
form	lyophilized
mol wt	calculated mol wt ~ 118.17 kDa, observed mol wt ~ 95 kDa
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	affinity binding assay: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable
isotype	IgG
conjugate	unconjugated
shipped in	ambient
storage temp.	2-8°C

WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Clone A12W is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects NMDAR2A.

Anti-NMDAR2A Antibody, clone A12W, ZooMAb® Rabbit Monoclonal

His-tagged recombinant fragment corresponding to 200 amino acids from the C-terminal region.

Anti-NMDAR2A, clone A12W ZooMAb, Cat. No. ZRB04901, is a recombinant Rabbit Monoclonal Antibody that targets NMDA2A receptor and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Western Blotting Analysis: A 1:2,000 dilution from a representative lot detected NMDAR2A in mouse brain tissue lysate.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected NMDAR2A in SH-SY5Y cells.
Immunohistochemistry (Paraffin) Analysis: A 1:200 dilution from a representative lot detected NMDAR2A in rat brain tissue sections.
Target description
Glutamate receptor ionotropic, NMDA 2A (UniProt: Q12879; also known as GluN2A, Glutamate [NMDA] receptor subunit epsilon-1, N-methyl D-aspartate receptor subtype 2A, NMDAR2A, NR2A, hNR2A) is encoded by the GRIN2A (also known as NMDAR2A) gene (Gene ID: 2903) in human. NMDA receptor complexes are ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. They are involved in long-term potentiation and neuronal plasticity and regulate the number of nerve cells during development. However, over-stimulation NMDA receptors can lead to neuronal degeneration. NMDAR2A is a multi-pass membrane protein that is synthesized with a signal peptide (aa 1-22), which is subsequently cleaved off. NMDAR2A exists as a heterotetramer and the heterotetrameric channels are composed of two zeta subunits (GRIN1), and two epsilon subunits (GRIN2A, GRIN2B, GRIN2C or GRIN2D) (in vitro). It can also form heterotetrameric channels that contain at least one zeta subunit (GRIN1), at least one epsilon subunit, plus GRIN3A or GRIN3B. In vivo, the subunit composition may depend on the expression levels of the different subunits. These heterotetrameric, ligand-gated ion channels display with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by magnesium ions. It has been shown that channels containing GRIN1 and GRIN2A have higher sensitivity to glutamate and faster kinetics than channels formed by GRIN1 and GRIN2B. Mutations in GRIN2A gene are known to cause epilepsy, speech disorders, and mental retardation. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
120 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.

biological source	rabbit (recombinant)
recombinant	expressed in HEK 293 cells
antibody form	purified antibody
antibody product type	primary antibodies
clone	A12W, monoclonal","recombinant monoclonal
product line	ZooMAb^®
form	lyophilized
mol wt	calculated mol wt 165.28 kDa","observed mol wt ~170 kDa
species reactivity	mouse, rat, human
packaging	antibody small pack of 25 µL
greener alternative product characteristics	Waste Prevention Designing Safer Chemicals Design for Energy Efficiency.
enhanced validation	recombinant expression
application(s)	immunocytochemistry: suitable using 1:100","immunohistochemistry (formalin-fixed, paraffin-embedded sections): 1:100-1:200","western blot: 1:1,000-1:2,000
isotype	IgG
conjugate	unconjugated
UniProt accession no.	Q12879,
shipped in	ambient
storage temp.	2-8°C
Gene Information	human ... GRIN2A;NMDAR2A(2903)

Anti-NME5 antibody produced in rabbit

HPA044555 Human Protein Atlas characterization data

non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST80008,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunohistochemistry: 1:1000-1:2500
immunogen sequence	FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
conjugate	unconjugated
UniProt accession no.	P56597,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NME5(8382)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NME7 antibody produced in rabbit

HPA038014 Human Protein Atlas characterization data

non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST76835,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	KGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKI
conjugate	unconjugated
UniProt accession no.	Q9Y5B8,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NME7(29922)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NME8 antibody produced in rabbit

HPA019259 Human Protein Atlas characterization data

The gene NME8 (NME/NM23 family member 8) is mapped to human chromosome 7p14.1. It belongs to the thioredoxin family. NME8 is expressed in human testis, mainly in primary spermatocytes. The protein contains an amino-terminal thioredoxin domain. NME8 localizes mainly in the cytoplasm but also shows weaker punctuated pattern in the nucleus. NME8 is commonly referred to as SPTRX2 (spermatid-specific thioredoxin-2) or TXNDC3 (thioredoxin domain-containing protein 3).

Thioredoxin domain-containing protein 3 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NME8 (NME/NM23 family member 8) is involved in primary ciliary dyskinesia (PCD), a condition with chronic respiratory tract infections, left-right asymmetry randomization, and male infertility. Single nucleotide polymorphism in NME8 is associated with knee osteoarthritis susceptibility.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74467,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100,
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	recombinant expression Learn more about Antibody Enhanced Validation,
application(s)	immunoblotting: 0.04-0.4 µg/mL, immunohistochemistry: 1:200-1:500
immunogen sequence	AQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENED
conjugate	unconjugated
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... TXNDC3(51314)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NME9 antibody produced in rabbit

HPA040000 Human Protein Atlas characterization data

NME/NM23 family member 9

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST88631,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent orthogonal RNAseq
application(s)	immunohistochemistry: 1:20- 1:50
isotype	IgG
immunogen sequence	AVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGEEAFEKLVHHMCSGPSHLLILTRTEGFEDVVTTWRTV
conjugate	unconjugated
UniProt accession no.	Q86XW9,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NME9(347736)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NMNAT2

HPA061714 Human Protein Atlas characterization data

Recombinant protein corresponding to nicotinamide nucleotide adenylyltransferase 2
Sequence
LLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVD

Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

biological source	rabbit
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunohistochemistry: 1:200-1:500
conjugate	unconjugated
UniProt accession no.	Q9BZQ4,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NMNAT2(23057)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NMRAL1 antibody produced in rabbit HPA041353-100UL

HPA041353 Human Protein Atlas characterization data

NmrA-like family domain containing 1 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST82281,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
enhanced validation	recombinant expression
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	SVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGAEVVQGDQDDQVIMELALNGAYATFIVTNYWESCSQEQEVKQGKLLADLARRLGLHYVVYS
conjugate	unconjugated
UniProt accession no.	Q9HBL8,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NMRAL1(57407)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Glycylpeptide N-tetradecanoyltransferase 1 recombinant protein epitope signature tag (PrEST)

Anti-NMT1 antibody produced in rabbit

MDL number:	MFCD02263837
Human Protein Atlas Number:	HPA022963 Human Protein Atlas characterization data

Anti-NMT1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),. Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NMT1 (N-myristoyltransferase 1) is responsible for myristoylation of proteins. It is needed for the transfer of myristate from myristoyl coenzyme A to the amino-terminal glycine in the target protein. NMT1 also promotes the replication of HIV (human immunodeficiency virus)-1 by controlling viral RNA expression. Additionally, it also participates in tumor cell proliferation.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST75702,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	mouse, rat, human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	KGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTH
conjugate	unconjugated
UniProt accession no.	P30419,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NMT1(4836)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Glycylpeptide N-tetradecanoyltransferase 2 recombinant protein epitope signature tag (PrEST)

Anti-NMT2 antibody produced in rabbit

MDL number:	MFCD02263838
Human Protein Atlas Number:	HPA001303 Human Protein Atlas characterization data

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NMT2 (N-myristoyltransferase 2) encodes a protein that adds a myristoyl group from myristoyl coenzyme A to the N-terminal glycine residue of proteins. N-terminal myristoylation is a common modification of many signaling proteins and serves as an integral role in targeting and functioning of these proteins. Human NMT2 protein shares 77% sequence homology with human NMT1 and has a molar mass of 65kDa.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST77882,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	RNAi knockdown
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:500-1:1000
immunogen sequence	GGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLL
conjugate	unconjugated
UniProt accession no.	O60551,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NMT2(9397)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1

Anti-NNMT antibody produced in rabbit

HPA059180 Human Protein Atlas characterization data

nicotinamide N-methyltransferase

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST85692,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200
immunogen sequence	GFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRP
conjugate	unconjugated
UniProt accession no.	P40261,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NNMT(4837)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NNT antibody produced in rabbit

HPA004829 Human Protein Atlas characterization data

NNT (nicotinamide nucleotide transhydrogenase) is an integral protein of the inner mitochondrial membrane. It is composed of three subunits termed dI, dII and dIII. The dI component binds to the NAD(+)/NADH, and the dIII binds to the NADP(+)/NADPH, protrude from the membrane.

NAD(P) transhydrogenase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
NNT (nicotinamide nucleotide transhydrogenase) acts as an antioxidant defense gene. It catalyzes the transhydrogenation reaction of transferring hydride ion from NAD(H) to NADP(H). In reverse transhydrogenation, it acts by the outward proton translocation and formation of a proton motive force. It has been reported that NNT may also participate in reactive oxygen species (ROS) detoxification in human adrenal glands. Mutations in NNT gene cause familial glucocorticoid deficiency.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86820,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	orthogonal RNAseq
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT
conjugate	unconjugated
UniProt accession no.	Q13423,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NNT(23530)

Personal Protective Equipment	Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US),
RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NOA1 antibody produced in rabbit

HPA035838 Human Protein Atlas characterization data

Uncharacterized protein C4orf14 recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST79697,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100,
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	independent Learn more about Antibody Enhanced Validation,
application(s)	immunoblotting: 0.04-0.4 µg/mL, immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:20-1:50
immunogen sequence	VLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLAPGHQGPQRPVKDEPQDGENPNPPNWSRTVVRDVRLISAKTGYGV
conjugate	unconjugated
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... C4orf14(84273)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable

Anti-NOC2L antibody produced in rabbit

HPA044258 Human Protein Atlas characterization data

nucleolar complex associated 2 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST83636,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

biological source	rabbit
Quality Level	100
antibody form	affinity isolated antibody
antibody product type	primary antibodies
clone	polyclonal
product line	Prestige Antibodies^® Powered by Atlas Antibodies
form	buffered aqueous glycerol solution
species reactivity	human
packaging	antibody small pack of 25 µL
enhanced validation	RNAi knockdown
application(s)	immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500
immunogen sequence	LTVDEFLASGFDSESESESENSPQAETREAREAARSPDKPGGSPSASRRKGRASEHKDQLSRLKDRDPEFYKFLQENDQSLLNFSDS
conjugate	unconjugated
UniProt accession no.	Q9Y3T9,
shipped in	wet ice
storage temp.	20°C
Gene Information	human ... NOC2L(26155)

RIDADR	NONH for all modes of transport
WGK Germany	WGK 1
Flash Point F	Not applicable
Flash Point C	Not applicable