Protein Biology
- Сортировать:
- Вид таблицей
-
Anti-OTC antibody produced in rabbit
Human Protein Atlas Number: HPA000243 Human Protein Atlas characterization data
Кат. номер HPA000243-100UL HPA000243-25UL General descriptionOrnithine transcarbamylase (OTC) is mapped to human chromosome Xp11.4 It is expressed in hepatocytes and enterocytes and belongs to the transcarbamylase family. Its precursor possesses a N-terminal signal peptide. OTC exists as anabolic and catabolic forms. Structurally, OTC comprises two lobes with the substrate carbamoyl phosphate (CP) binding pocket in between them. The conserved Ser-Thr-Arg-Thr-Arg motif is essential for CP binding.ImmunogenOrnithine carbamoyltransferase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)ApplicationAnti-OTC antibody produced in rabbit has been used in:- western blotting
- immunofluorescence
- immunohistochemical staining
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Ornithine transcarbamylase (OTC), a urea cycle enzyme, catalyzes the conversion carbamoyl phosphate and ornithine to citrulline. It is a key enzyme for ammonia synthesis as well as for the catabolism of amino acids. The active site lysine 88 residue is crucial for binding carbamoyl phosphate. The anabolic OTC is involved in the urea cycle and arginine biosynthesis. The catabolic OTC participates in the arginine deiminase pathway and citrulline breakdown. A deficiency in OTC leads to urea cycle disruption resulting in ornithine transcarbamylase disorder (OTCD).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74006,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
independentapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:2500-1:5000 immunogen sequence ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT conjugate unconjugated UniProt accession no. P00480, shipped in wet ice storage temp. 20°C Gene Information human ... OTC(5009)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OTOR antibody produced in rabbit
Human Protein Atlas Number: HPA024335 Human Protein Atlas characterization data
Кат. номер HPA024335-100UL HPA024335-25UL ImmunogenOtoraplin Precursor recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71893,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence RLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE conjugate unconjugated UniProt accession no. Q9NRC9, shipped in wet ice storage temp. 20°C Gene Information human ... OTOR(56914)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OTUB1 antibody produced in rabbit
Human Protein Atlas Number: HPA039176 Human Protein Atlas characterization data
Кат. номер HPA039176-100UL HPA039176-25UL ImmunogenOTU deubiquitinase, ubiquitin aldehyde binding 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78780,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation RNAi knockdown application(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence AAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPD conjugate unconjugated UniProt accession no. Q96FW1, shipped in wet ice storage temp. 20°C Gene Information human ... OTUB1(55611)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OTUB2 antibody produced in rabbit
Human Protein Atlas Number: HPA002329 Human Protein Atlas characterization data
Кат. номер HPA002329-100UL HPA002329-25UL General descriptionOTU deubiquitinase, ubiquitin aldehyde binding 2 (OTUB2) is a 29kDa, cysteine protease belonging to the OTU (ovarian tumour) superfamily of proteins. It has two isoforms namely otubain 1 and otubain 2. Both the otubains consist of OTU domain with an active cysteine protease site. It has short carboxy-terminal extension which makes it different from OTUB1. It is involved in mediating lymphocyte antigen responsiveness.ImmunogenOTU deubiquitinase, ubiquitin aldehyde binding 2ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
OTUB2 (OTU deubiquitinase, ubiquitin aldehyde binding 2) plays an important role in protein degradation machinery and in specific ubiquitin dependent pathways. It forms a complex with Uba (Ub-associated domains). Its activity is inhibited by mutation of the active site cysteine (C51S). It contains conserved cysteine, histidine and aspartate residues that help in the putative catalytic cysteine protease activity. It also consists of a nuclear localization signals (NLS) and a consensus LxxLL motif that mediates the binding of transcriptional co-activators to nuclear receptors.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST70530,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:200-1:500 immunogen sequence YSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNIL conjugate unconjugated UniProt accession no. Q96DC9, shipped in wet ice storage temp. 20°C Gene Information human ... OTUB2(78990)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OTUD6A antibody produced in rabbit
Human Protein Atlas Number: HPA053304 Human Protein Atlas characterization data
Кат. номер HPA053304-100UL HPA053304-25UL ImmunogenOTU deubiquitinase 6AApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST83838,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression
orthogonal RNAseqapplication(s) immunohistochemistry: 1:2500-1:5000","western blot: 0.04-0.4 µg/mL immunogen sequence HRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEE conjugate unconjugated UniProt accession no. Q7L8S5, shipped in wet ice storage temp. 20°C Gene Information human ... OTUD6A(139562)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OTUD6B antibody produced in rabbit HPA024046-100UL
Human Protein Atlas Number: HPA024046 Human Protein Atlas characterization data ImmunogenOTU domain containing 6B recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76294,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation independent application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence IQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLV conjugate unconjugated UniProt accession no. Q8N6M0, shipped in wet ice storage temp. 20°C Gene Information human ... OTUD6B(51633)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OTULIN antibody produced in rabbit
Human Protein Atlas Number: HPA051074 Human Protein Atlas characterization data
Кат. номер HPA051074-100UL HPA051074-25UL General descriptionOvarian tumor (OTU) deubiquitinase with linear linkage specificity (OTULIN) is a deubiquitinase enzyme. The gene is located on human chromosome 5p15.2.ImmunogenOTU deubiquitinase with linear linkage specificityApplicationAnti-OTULIN antibody produced in rabbit has been used in immunoprecipitation.
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Ovarian tumor (OTU) deubiquitinase with linear linkage specificity (OTULIN) provides protection from inflammation and maintains immune homeostasis. It protects from TNF (tumor necrosis factor)-associated systemic inflammation. Mutation in this gene is linked to fatal autoinflammatory condition, known as OTULIN-related autoinflammatory syndrome (ORAS). It particularly cleaves methionine-linked ubiquitin (Met1-Ub). This protein regulates NF-κB signalling pathway.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST84188,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100, antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation,application(s) immunoblotting: 0.04-0.4 µg/mL, immunofluorescence: 0.25-2 µg/mL, immunohistochemistry: 1:500-1:1000 immunogen sequence DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP conjugate unconjugated shipped in wet ice storage temp. 20°C Gene Information human ... FAM105B(90268)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OVGP1 antibody produced in rabbit
Human Protein Atlas Number: HPA062205 Human Protein Atlas characterization data
Кат. номер HPA062205-100UL HPA062205-25UL Immunogenoviductal glycoprotein 1, 120kDaApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76552,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence GTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDE conjugate unconjugated UniProt accession no. Q12889, shipped in wet ice storage temp. 20°C Gene Information human ... OVGP1(5016)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OXCT1 antibody produced in rabbit
Human Protein Atlas Number: HPA061425 Human Protein Atlas characterization data
Кат. номер HPA061425-100UL HPA061425-25UL Immunogen3-oxoacid CoA transferase 1ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST88295,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:200-1:500 isotype IgG immunogen sequence ATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGA conjugate unconjugated UniProt accession no. P55809, shipped in wet ice storage temp. 20°C Gene Information human ... OXCT1(5019)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OXCT2
Human Protein Atlas Number: HPA075423 Human Protein Atlas characterization data
Кат. номер HPA075423-100UL HPA075423-25UL ImmunogenRecombinant protein corresponding to 3-oxoacid CoA-transferase 2
Sequence
RLTILKEEDGDAGKEEDARTRIIRRApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50-1:200 conjugate unconjugated UniProt accession no. Q9BYC2, shipped in wet ice storage temp. 20°C Gene Information human ... OXCT2(64064)
Safety InformationRIDADR NONH for all modes of transport Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OXR1 antibody produced in rabbit
Human Protein Atlas Number: HPA027395 Human Protein Atlas characterization data
Кат. номер HPA027395-100UL HPA027395-25UL Immunogenoxidation resistance 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST76336,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq
recombinant expression
independentapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence EEYGIMCPMEEVMSAAMYKEILDSKIKESLPIDIDQLSGRDFCHSKKMTGSNTEEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIR conjugate unconjugated UniProt accession no. Q8N573, shipped in wet ice storage temp. 20°C Gene Information human ... OXR1(55074)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-OXSM antibody produced in rabbit
Human Protein Atlas Number: HPA021293 Human Protein Atlas characterization data
Кат. номер HPA021293-100UL HPA021293-25UL General descriptionOXSM (β-ketoacyl-ACP synthase) localizes in the mitochondria. OXSM transcripts are strongly expressed in the heart and skeletal muscle, liver and kidney. However, it is also present in the placenta, brain, spleen and lung.Immunogen3-oxoacyl- recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
OXSM (β-ketoacyl-ACP synthase) is an important enzyme of the mitochondrial fatty acid synthesis II (mtFAS II) pathway. It is required for the chain-elongating reaction in the fatty acid synthesis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST75495,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
recombinant expressionapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL conjugate unconjugated UniProt accession no. Q9NWU1, shipped in wet ice storage temp. 20°C Gene Information human ... OXSM(54995)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Узнать цену -
Anti-OXSR1 antibody produced in rabbit HPA008237-100UL
Human Protein Atlas Number: HPA008237 Human Protein Atlas characterization data General descriptionOxidative stress responsive 1 (OXSR1) is a 58kDa protein having 527 amino acids. It belongs to the Ste20p family of proteins which are serine/threonine-protein kinases. OXSR1 is expressed in mammalian tissues and cell lines.ImmunogenSerine/threonine-protein kinase OSR1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
Oxidative stress responsive 1 (OXSR1) phosphorylates the threonine-84 residue in the amino-terminal regulatory domain of the p21-activated protein kinase (PAK1), thereby modulating the G protein sensitivity of PAK1. It also regulates and modulates the activities of PAK2 and PAK3. The carboxyl-terminus of OXSR1 binds to gelsolin, an actin-binding protein. It associates with growing ends of actin filaments and nucleates actin assembly. Thus, OXSR1 regulates the actin cytoskeleton. It also interacts with and phosphorylates three RELT (Receptor expressed in lymphoid tissues) family members, RELT, RELL2 (RELT-like protein 2) and RELL1 which are involved in tumor necrosis factor (TNF) receptor mediated pathway.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST71456,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence FDEESEEGKAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDIRFE conjugate unconjugated UniProt accession no. O95747, shipped in wet ice storage temp. 20°C Gene Information human ... OXSR1(9943)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-p-4E-BP1 (Thr37/46) Antibody, clone 1N7 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1403-25UL ZRB1403-4X25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1N7 is a ZooMAb® Rabbit recombinant monoclonal antibody that specifically detects 4E-BP1 protein phosphorylated on threonine 37 and 46.ImmunogenKLH-conjugated linear peptide corresponding to 16 amino acids surrounding phosphothreonine 37and 46 from the N-terminal region of human 4E-BP1.ApplicationAnti-p-4E-BP1 (Thr37/46), clone 1N7 ZooMAb®, Cat. No. ZRB1403, is a recombinant Rabbit monoclonal antibody that detects p4E-BP1 and is used in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry, Peptide Inhibition, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting in BALB/3T3 A31 cell lysate.
Western Blotting Analysis (WB): A 1:10,000 dilution of this antibody detected 4E-BP1 phosphorylated on Threonine 37 and 46 in lysate from overnight serum starved and PDGF treated ( 50 ng/mL) Balb/3T3 A31 cells.
Tested applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected p-4E-BP1 (Thr37/46) in lysate from NIH3T3 cells stimulated with PDGF (50 ng/mL)
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected p-4E-BP1 (Thr37/46) in human pancreas and human colon cancer tissue sections.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected p-4E-BP1 (Thr37/46) in NIH 3T3 cells with and without PDGF treatment.
Peptide Inhibition Assay: Target band detection in lysate from NIH3T3 cells treated with PDGF was prevented by preblocking of a representative lot with the immunogen phosphopeptide ( p-4E-BP1), but not the corresponding non-phosphopeptide.
Affinity Binding Assay: A representative lot of this antibody bound phospho and non-phospho 4E-BP1-Thr37+46 peptides with a KD of 1x 10^-12 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Eukaryotic translation initiation factor 4E-binding protein 1 (UniProt: Q13541; also known as 4E-BP1, eIF4E-binding protein 1, Phosphorylated heat- and acid-stable protein regulated by insulin 1, PHAS-I) is encoded by the EIF4EBP1 gene (Gene ID: 1978) in human. 4E-BP1 is a member of a family of translation repressor proteins, and a well-known substrate of mTOR signaling pathway. In response to upstream stimuli, such as insulin, EGF, and PDGF, mTORC1 is shown to phosphorylate S6 kinase 1 (S6K1) and 4E-BP1 that stimulates protein synthesis. About 30% of the 4E-BP1 expressed in cells is localized in the nucleus, where it regulates the availability of eIF4E for the cytoplasmic translational machinery, by retaining eIF4E in the nucleus. 4E-BP1 can undergo phosphorylation at multiple sites (Thr 37, 46, 70 and Ser 65, 83, 101, and 112) and the first five sites are phylogenetically conserved among all species. The phosphorylated form is also considered as a marker of activated mTOR signaling. Phosphorylation at Thr37 and Thr46 serves as a priming event, which is followed by phosphorylation at Thr70 and then at Ser 65. The hyper-phosphorylated form is regulated by mTORC1 and abolishes binding to elF4E. Several other kinases have also been shown to phosphorylate 4E-BP1 dependent or independent of mTOR. Phosphorylation of 4E-BP1 at Thr37 and Thr46 by GSK3 reduces its association with elF4E and its release from eIF4E allows cap-dependent translation to proceed. High level of phosphorylated 4E-BP1 is reported in several human cancers and is associated with an unfavorable outcome in several malignancies. Overexpression of cytosolic 4E-BP1 is reported to orchestrate a hypoxia-activated switch from cap-dependent to cap-independent mRNA translation that promotes increased tumor angiogenesis and growth at the level of selective mRNA translation. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Qin, X., et al. (2016). Cell Cycle. 15(6); 781-786).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rabbit recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1N7, recombinant monoclonal description recombinant, expressed in HEK 293 cells product line ZooMAb® form lyophilized mol wt calculated mol wt 12.58 kDa","observed mol wt ~15 kDa purified by using Protein A species reactivity mouse, human species reactivity (predicted by homology) feline, canine, porcine, bovine, monkey packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) affinity binding assay: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG epitope sequence Unknown conjugate unconjugated Protein ID accession no. NP_004086, UniProt accession no. Q13541, shipped in ambient storage temp. 2-8°C Узнать цену -
Anti-p-ATM (Ser1981) Antibody, clone 1E19, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1370-25UL ZRB1370-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 1E19 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects human ATM phosphorylated on serine 1981.ImmunogenKLH-conjugated linear peptide corresponding to 15 amino acids surrounding phosphoserine 1981 from the C-terminal half of human ATM.ApplicationAnti-p-ATM (Ser1981), clone 1E19 ZooMAb, Cat. No. ZRB1370, a Rabbit monoclonal antibody that targets p-ATM (Ser1981) and is tested in Affinity Binding, Immunohistochemistry, Peptide Inhibition Assay, and Western Blotting.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected p-ATM (Ser1981) in HeLa cells treated with camptothecin (10 mM; 4 h)
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected p-ATM (Ser1981) in human breast cancer tissue sections.
Peptide Inhibition Assay: Target band detection in lysate from UV treated HeLa cells was prevented by pre-blocking of a representative lot with the phosphor-ATM peptide, but not with the corresponding non-phosphopeptide.
Analysis: A 1:1,000 dilution from a representative lot was used with HeLa cells treated with UV light for peptide block analysis.
Affinity Binding Assay: A representative lot of this antibody bound human phosphorylated ATM (pSer1981) with a KD of 8.26 x 10-8 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user.
Target description
Serine-protein kinase ATM (UniProt: Q13315; also known as EC:2.7.11.1, Ataxia telangiectasia mutated, A-T mutated, ATM) is encoded by the ATM gene (Gene ID: 472) in human. ATM is a member of the phosphatidyl inositol 3-kinase-like kinase (PIKK) family that is activated in response to double-strand breaks (DSBs) induced by ionizing radiation and radiomimetic drugs. It is usually found localized near the damaged regions within several minutes indicting its damage-sensing role. After their recruitment to sites of DNA damage, ATM phosphorylate several intracellular substrates, including Chk1 and Chk2 that in turn target other proteins to induce cell-cycle arrest and allow DNA repair to proceed. In normal cells ATM is present as inert dimers or multimers, which dissociate into highly active ATM monomers following any DNA damage. During activation, ATM undergoes autophosphorylation on Ser1981 and the activated ATM undergoes additional phosphorylations and acetylation reactions. Defects in ATM signaling are commonly seen in human cancer cells and they affect the sensitivity of tumors to chemo- and radiation therapies. Mutations in ATM gene are known to cause Ataxia telangiectasia that is characterized by progressive cerebellar ataxia, dilation of the blood vessels in the conjunctiva and eyeballs, immunodeficiency, growth retardation and a strong predisposition to cancers. Defects in ATM may contribute to T-cell acute lymphoblastic leukemia and T-prolymphocytic leukemia. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Shiloh, Y., and Ziv, Y. (2013). Nat. Rev. Mol. Cell Biol. 14(4); 197-210).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
30 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1E19, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 350.69 kDa, observed mol wt ~370 kDa species reactivity human packaging pkg of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, immunohistochemistry: suitable, inhibition assay: suitable (peptide), western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-p-histone H2A (Ser139) Antibody, clone JBW301 ZooMAb® Mouse Monoclonal
Кат. номер ZMS05636-4X25UL ZMS05636-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone JBW301 is a ZooMAb mouse recombinant monoclonal antibody that specifically detects Histone H2A phosphorylated on serine 139.ImmunogenKLH-conjugated linear peptide corresponding to 9 amino acids surrounding phosphoserine 139.ApplicationAnti-p-histone H2A (Ser139), clone JBW301 ZooMAb, Cat. No. ZMS05636, is a recombinant Mouse monoclonal antibody that detects Histone H2A phosphorylated on Ser139 and is tested in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting
Immunocytochemistry Analysis: A 1:1,000 dilution from a representative lot detected p-histone H2A (Ser139) in HeLa cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected p-histone H2A (Ser139) in rat colon and human colon tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Histone H2AX (UniProt: P16104; also known as H2a/x, Histone H2A.X) is encoded by the H2AFX (also known as H2AX) gene (Gene ID: 3014) in human. Histones are highly conserved basic nuclear proteins that are responsible for the nucleosome structure of chromatin in eukaryotes. They play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which DNA is wrapped in repeating units, called nucleosomes, which limits DNA accessibility to the cellular machineries that require DNA as a template. The histone H2A.X is a variant member of the H2A family of histones that is distinguished from other H2A histones by a unique carboxy-terminal sequence. This unique sequence is highly conserved throughout eukaryotic evolution and is rapidly phosphorylated by ATM or ATR at Serine 139 in mammals in response to DNA double-strand breaks. H2A.X phosphorylation is important in the formation of a stable repair complex at the site of DNA damage. Phosphorylation of H2A.X is important in the formation of a stable repair complex at the site of DNA damage. This phosphorylation is a very rapid response to DNA damage, occurring within as little as one minute after exposure to ionizing radiation. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
0.3 mg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source mouse (recombinant) Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone JBW301, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 15.15 kDa, observed mol wt ~15 kDa species reactivity rat, human species reactivity (predicted by homology) vertebrates packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG1 conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-p-PTEN (Tyr240) Antibody, clone 3G6 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB2134-4X25UL ZRB2134-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.SpecificityClone 3G6 is a ZooMAb® rabbit recombinant monoclonal antibody that specifically detects PTEN. It targets an epitope surrounding phosphotyrosine 240.ImmunogenBSA-conjugated linear peptide corresponding to 17 amino acids surrounding phosphotyrosine 240 from the C-terminal half of human PTEN.ApplicationAnti-p-PTEN (Tyr240), clone 3G6 ZooMAb®, Cat. No. ZRB2134, is a recombinant Rabbit monoclonal antibody that specifically detects PTEN phosphorylated on Tyr240 and is tested for use in Affinity Binding Assay, Immunohistochemistry, and Western Blotting.
Quality Control Testing
Evaluated by Immunohistochemistry (Paraffin) in human astrocytoma tissue sections.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution of this antibody detected PTEN phosphorylated on tyrosine 240 in human astrocytoma tissue sections.
Tested applications
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected PTEN phosphorylated on tyrosine 240 in normal human brain tissue sections.
Immunohistochemistry Applications: A representative lot detected PTEN phosphorylated on tyrosine 240 in Immunohistochemistry applications (Ma, J., et. al. (2019). Cancer Cell. 35(3):504-518).
Affinity Binding Assay: A representative lot of this antibody bound phopho-PTEN (Tyr240) peptide with a KD of 1.0 x 10-12 in an affinity binding assay.
Western Blotting Analysis: A 1:10,000 dilution from a representative lot detected wild-type PTEN, but not the mutant PTEN.
Western Blotting Analysis: A representative lot detected PTEN phosphorylated on tyrosine 240 in Western Blotting applications (Ma, J., et. al. (2019). Cancer Cell. 35(3):504-518).
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (UniProt: P60484; also known as Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) is encoded by the PTEN (also known as MMAC1, TEP1) gene (Gene ID: 5728) in human. PTEN belongs to the family of lipid phosphatases. It contains an N-terminal phosphatase catalytic domain, a C2-domain that binds to phospholipid membranes, and a C-terminal regulatory tail. It is a dual-specific phosphatase, which dephosphorylates both lipid and protein substrates. PTEN suppresses the activity of a major cell proliferation pathway in the cytoplasm; as such, its absence or functional deficiency is associated with tumor growth. PTEN blocks the phosphatidylinositol 3-kinase/Akt signaling pathway by removing the phosphate in the 3-position on phosphoinositide-3, 4, 5-trisphosphate (PIP3). Dephosphorylation of PIP3 is an important factor in cell growth, proliferation, apoptosis, and survival. Dephosphorylation of PIP3 blocks Akt signaling that can lead to higher activity of pro-apoptotic molecules such as Bad and Caspase-9. PTEN activity, stability, localization, and conformation are controlled through complex regulatory mechanisms, including the reversible phosphorylation of several Serine/Threonine residues in its unfolded C-terminal tail region (PTEN-C-tail, residues 351-403). Alternative translation of PTEN is reported to encode a 576-amino acid translational variant that is known as PTEN-Long with a 173-amino acid domain at its N-terminus followed by the classical 403 amino acids of PTEN. PTEN-Long is a membrane permeable, secreted protein that can enter other cells and acts as an antagonist of the PI3K pathway. PTEN is considered a major tumor suppressor and its mutations are reported in several human tumors. Over seventy different types of PTEN mutation have been recorded in patients with Cowden syndrome. PTEN -/- mice exhibit higher levels of 3 -phosphorylated phospholipids and die during embryogenesis due to the failure of developmental apoptosis. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Ferrarelli, LK., et al. (2019). Sci. Signal 16(577); eaax6492; Hopkins, BD., et al. (2013). Science. 341(6144); 399-402).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rabbit recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 3G6, recombinant monoclonal description recombinant, expressed in HEK 293 cells product line ZooMAb® form lyophilized mol wt calculated mol wt 47.17 kDa","observed mol wt ~52 kDa species reactivity human species reactivity (predicted by homology) monkey, rat, mouse, bovine packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) affinity binding assay: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG epitope sequence C-terminal half conjugate unconjugated Protein ID accession no. NP_000305.3, UniProt accession no. P60484, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-p-Ubiquitin (pSer65) Antibody, clone 2N21 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1494-25UL ZRB1494-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 2N21 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects ubiquitin phosphorylated on serine 65.ImmunogenKLH-conjugated linear peptide corresponding to 13 amino acids from the ubiquitin-like 1 domain of human polyubiquitin phosphorylated on serine 65.ApplicationWestern Blotting Analysis: A 1:1,000 dilution from a representative lot detected p-Ubiquitin (pSer65) in lysate from HeLa cells transfected with PINK and treated with CCCP.
Flow Cytometry Analysis: 0.1 µg from a representative lot detected p-Ubiquitin (pSer65) in one million PC-3 cells treated with CCCP.
Peptide Inhibition Assay: Target band detection in lysate from HeLa cells transfected with PINK and treated with CCCP (15 mM, 5 h) was prevented by preblocking of a representative lot with the phosphorylated Ser 65 ubiquitin peptide, but not by corresponding non-phosphopeptide.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected p-Ubiquitin (pSer65) in HeLa cells transfected with PINK and treated wtih CCCP.
Affinity Binding Assay: A representative lot of this antibody bound phosphorylated serine 65 Ubiquitin peptide with a KD of 2.5 x 10-8 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-p-Ubiquitin (pSer65), clone 2N21 ZooMAb, Cat. No. ZRB1494, is a recombinant Rabbit monoclonal antibody to detect ubiquitin (pSer65) in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, Peptide Inhibition Assay, and Western Blotting.
Target description
BDNF/NT-3 growth factors receptor (UniProt: Q16620; also known as EC:2.7.10.1, GP145-TrkB, Trk-B, Neurotrophic tyrosine kinase receptor type 2, TrkB tyrosine kinase, Tropomyosin-related kinase B) is encoded by the NTRK2 (also known as TRKB) gene (Gene ID: 4915) in human. TrkB is a single-pass type I membrane protein that is internalized to endosomes upon ligand-binding. It is synthesized with a signal peptide (aa 1-31) that is subsequently cleaved off to generate the mature form that contains an extracellular domain (aa 32-430), a transmembrane domain (aa 431-454), and a cytoplasmic domain (aa 455-822). TrkB is a receptor tyrosine kinase that is involved in the development and maturation of the central and the peripheral nervous systems through regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. In the central nervous system, its expression is observed in the cerebral cortex, hippocampus, thalamus, choroid plexus, granular layer of the cerebellum, brain stem, and spinal cord. In the peripheral nervous system, it is expressed in many cranial ganglia, the ophthalmic nerve, the vestibula, and multiple facial structures. Upon ligand-binding, it undergoes homodimerization, autophosphorylation, and activation. It can then recruit, phosphorylate and/or activate several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that regulate distinct overlapping signaling cascades. TrkB is also reported to play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. Following binding of BDNF to TrkB receptor, Tyrosine 816 is phosphorylated, which allows the binding of phospholipase C gamma and activation of signaling cascade. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
0.03 mg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 2N21, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized species reactivity human species reactivity (predicted by homology) mouse, rat packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, flow cytometry: suitable, immunocytochemistry: suitable, inhibition assay: suitable (peptide), western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-p14ARF Antibody, clone 4F19 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1581-4X25UL ZRB1581-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 4F19 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects p14ARF.ImmunogenGST/His-tagged full-length human recombinant Tumor suppressor ARFApplicationAnti-p14ARF, clone 4F19 ZooMAb, Cat. No. ZRB1581, is a recombinant Rabbit monoclonal antibody that specifically targets p14ARF and is tested for use in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry, and Western Blotting.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected p14ARF in HeLa, A431, and NIH 3T3 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected p14ARF in human testis tissue sections.
Affinity Binding Assay: A representative lot of this antibody bound human recombinant p14ARF with a KD of 2.0 x 10-7 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Tumor suppressor ARF (UniProt: Q8N726; also known as Alternative reading frame, ARF, Cyclin-dependent kinase inhibitor 2A, p14ARF) is encoded by the CDKN2A (also known as CDKN2, MLM) gene (Gene ID: 1029) in human. p14ARF serves as a tumor suppressor and is a key regulator of cellular proliferation. It is shown to be frequently inactivated in human cancers. It binds to MDM2 and blocks its nucleocytoplasmic shuttling by sequestering it in the nucleolus. This inhibits the oncogenic action of MDM2 by blocking MDM2-induced degradation of p53 and enhances p53-dependent transactivation and apoptosis. Also induces G2 arrest and apoptosis by preventing the activation of cyclin B1/CDC2 complexes. It can form a ternary complex with p120(E4F) and p53 to enhance p14ARF-induced G2 cell cycle arrest in a p53-dependent manner. p14ARF also binds to E2F1 and MYC and blocks their transcriptional activator activity without affecting MYC transcriptional repression. Human p14ARF is shown to promote the proteasomal degradation of Melanoma antigen-A11 (MAGE-A11) independent of HDM2 E3 ubiquitin ligase or lysine ubiquitination. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Minges, JT et al. (2015). J. Biol. Chem. 290, 25174-25187. Rizos, H., et al. (2003). J. Biol. Chem. 278, 4981-4989).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 200, recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 4F19, monoclonal, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 13.9 kDa, observed mol wt ~38 kDa (GST-tagged recombinant protein) species reactivity human, mouse packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, immunocytochemistry: suitable, immunohistochemistry: suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Узнать цену -
Anti-p16 Antibody, clone D25 ZooMAb® Mouse Monoclonal
Кат. номер ZMS1072-4X25UL ZMS1072-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.SpecificityClone D25 is a ZooMAb® mouse recombinant monoclonal antibody that specifically detects Cyclin-dependent kinase inhibitor 2A (p16).ImmunogenRecombinant human p16 fusion protein.ApplicationAnti-p16, clone D25 ZooMAb®, Cat. No. ZMS1072, is a recombinant Mouse monoclonal antibody that detects p16 (CDKN2A) and is tested for use in Affinity Binding Assay, Flow Cytometry, Immunocytochemistry, and Western Blotting.
Quality Control Testing
Evaluated by Western Blotting with human recombinant p16 (CDKN2A)..
Western Blotting Analysis: A 1:10,000 dilution of this antibody detected human recombinant p16 (CDKN2A).
Tested applications
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected p16 in HeLa cells.
Flow Cytometry Analysis: 1 µg from a representative lot detected p16 in Hela cells.
Affinity Binding Assay: A representative lot of this antibody bound recombinant human p16 (CDKN2A) with a KD of 2.5 x 10-6 in an affinity binding assay.
Flow Cytometry Analysis: 1 µg from a representative lot detected p16 (CDKN2A) in one million HeLa cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Cyclin-dependent kinase inhibitor 2A (UniProt: P42771; also known as Cyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A) is encoded by the CDKN2A (also known as CDKN2, MTS1) gene (Gene ID: 1029) in human. p16 serves as a negative regulator of cell proliferation by strongly interacting with CDK4 and CDK6 during the G1-to S-phase transition and blocking the phosphorylation of retinoblastoma (Rb) protein. Hence, it is considered as a tumor suppressor protein. Hypo-phosphorylated Rb protein forms complexes with E2F family of transcription factors, which sequesters E2Fs and prevent their access to the promoters of proliferation-associated genes. During cell cycle, in the late G1 phase CDK4 and CDK6 hyper-phosphorylate Rb protein that commits cells to enter into S phase. Binding of p16 maintains Rb in a hypo-phosphorylated state. CDKN2A gene is reported to be one of the most frequently mutated genes and is reported to be inactivated in about 50% of all human cancers. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Li, J., et al. (2011). Biochemistry. 50(25); 5566-5582; Sherr, CJ., and Roberts, JM (2004). Genes Dev. 18(22); 2699-2711; Ortega, S., et al. (2002). Biochim. Biophys. Acta. 1602(1); 73-87).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source mouse recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone D25, recombinant monoclonal description recombinant, expressed in HEK 293 cells product line ZooMAb® form lyophilized mol wt calculated mol wt 16.53 kDa","observed mol wt ~16 kDa species reactivity human packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) affinity binding assay: suitable","flow cytometry: suitable","immunocytochemistry: suitable","western blot: suitable isotype IgG1 epitope sequence Unknown conjugate unconjugated UniProt accession no. P42771, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-p16-INK4a Antibody, clone 5F22 Antibody, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1437-4X25UL ZRB1437-25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 5F22 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects Cyclin-dependent kinase inhibitor 2A (p16-INK4a). It targets an epitope within the first 54 amino acids from the N-terminal.ImmunogenGST/His-tagged recombinant fragment corresponding to the first 54 amino acids from human Cyclin-dependent kinase inhibitor 2A (p16-INK4a).ApplicationAnti-p16-INK4a, clone 5F22, ZooMAb, Cat. No. ZRB1437, is a recombinant Rabbit monoclonal antibody that specifically targets p16-INK4a and is tested in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected p16-INK4a in HeLa, A431, HUVEC, and NIH3T3 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected p16-INK4a in human cervical cancer tissue sections.
Affinity Binding Assay: A representative lot of this antibody bound recombinant p16-INK4a protein with a KD of 4.5 x 10-7 in an affinity binding assay.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Target description
Cyclin-dependent kinase inhibitor 2A (UniProt: P42771; also known as Cyclin-dependent kinase 4 inhibitor A, CDK4I, Multiple tumor suppressor 1, MTS-1, p16-INK4a, p16-INK4, p16INK4A) is encoded by the CDKN2A (also known as CDKN2, MTS1) gene (Gene ID: 1029) in human. p16-INK4 is a widely distributed protein that acts as a negative regulator of proliferation of normal cells. It is reported to be the principal member of the IINK4 family of CDK inhibitors. It heterodimerizes with CDK4 or CDK6 and inhibits their ability to interact with cyclin D and to phosphorylate the retinoblastoma protein. It is considered a tumor suppressor protein because of physiological role and down-regulated expression in a large number of tumors. Overexpression of p16-INK4a has also been described in several tumors, including endometrial, colorectal and basal cell carcinoma. Six isoforms of p16-INK4a have been described that are produced by alternative splicing. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
0.3 mg/mL after reconstitution at 25μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommended storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 16.53 kDa, observed mol wt ~16 kDa species reactivity human, mouse packaging pkg of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) affinity binding assay: suitable, immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable isotype IgG conjugate unconjugated greener alternative category Aligned, shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-p21 Antibody, clone 5G7, ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1141-25UL ZRB1141-4X25UL General descriptionZooMAb antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb antibodies are reliably available and ready to ship when you need them.
Learn more about ZooMAb here.,
Specificity
Clone 5G7 is a ZooMAb rabbit recombinant monoclonal antibody that specifically detects p21/Waf1/Cip1 protein.ImmunogenHis-tagged full-length recombinant human Cyclin-dependent kinase inhibitor 1 (p21).ApplicationImmunocytochemistry Analysis: A 1:100 dilution from a representative lot detected p21 in HUVEC and NIH 3T3 cells.
Immunohistochemistry (Paraffin) Analysis: A 1:1,000 dilution from a representative lot detected p21 in human cervical cancer tissue sections.
Note: Actual optimal working dilutions must be determined by the end user as specimens and experimental conditions may vary.
Anti-p21, clone 5G7 ZooMAb , Cat. No. ZRB1141, is a recombinant rabbit monoclonal antibody that specifically targets p21-Waf1-Cip1 and has been tested for use in Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Cyclin-dependent kinase inhibitor 1 (UniProt: P38936; also known as CDK-interacting protein 1, Melanoma differentiation-associated protein 6, MDA-6, p21) is encoded by the CDKN1A (also known as CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1) gene (Gene ID:1026) in human. p21 belongs to the Cip and Kip family of CDK inhibitors. It binds to and inhibits cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. It binds tightly to the G1 and S phase kinases, cyclin E/Cdk2, cyclin D/Cdk4, and cyclin A/Cdk2, and effectively inhibits their activity. However, its effects on G2/M kinases is minimal. It binds the cyclin subunit through a conserved Cy1 motif in the N-terminal half and through a weaker and Cy2 motif in the C-terminal half. p21 also inhibits proliferating cell nuclear antigen (PCNA) and binds to and blocks the inactivation of retinoblastoma protein (Rb), which is essential for cell cycle progression. It is an important effector of p53 and is important in the DNA-damage checkpoint. It is expressed in all adult tissues, with 5-fold lower levels observed in the brain. Is cyclin binding site is localized to amino acids 17-24 and CDK binding occurs in the region of 53-58 residues. p21 is shown to suppress tumor growth by promoting cell cycle arrest in response to various stimuli. However, it is often misregulated in various human cancers. This ZooMAb recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Abbas, T., and Dutta, A (2009). Nat Rev Cancer. 9(6); 400-414).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose. Normal appearance is a coarse or translucent resin. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit (recombinant) recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 5G7, recombinant monoclonal product line ZooMAb® learn more, form lyophilized mol wt calculated mol wt 18.12 kDa, observed mol wt ~19 kDa species reactivity human, mouse packaging antibody small pack of 25 µL greener alternative product characteristics Waste Prevention
Designing Safer Chemicals
Design for Energy Efficiency
Learn more about the Principles of Green Chemistry,.enhanced validation recombinant expression
Learn more about Antibody Enhanced Validation,application(s) immunocytochemistry: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, western blot: suitable (peptide) isotype IgG conjugate unconjugated shipped in ambient storage temp. 2-8°C
Safety InformationWGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-p27 Kip1 Antibody, clone 1B10 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1429-4X25UL ZRB1429-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 1B10 is a ZooMAb® Rabbit recombinant monoclonal antibody that specifically detects p27 Kip1. It targets an epitope within 18 amino acids from the N-terminal region.ImmunogenKLH-conjugated linear peptide corresponding to 18 amino acids from the N-terminal region of human Cyclin-dependent kinase inhibitor p27 (p27 Kip1).ApplicationQuality Control Testing
Evaluated by Western Blotting in Jurkat cell lysate.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected p27 Kip1 in Jurkat cell lysate.
Tested applications
Western Blotting Analysis: A 1:1,000 dilution from a representative lot detected p27 Kip1 in HeLa cell lysate.
Affinity Binding Assay: A representative lot of this antibody bound in p27 Kip1 with a KD of 2.5 x 10-8 in an affinity binding assay.
Immunocytochemistry Analysis: A 1:100 dilution from a representative lot detected p27 Kip1 in HeLa cells and HUVEC.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected p27 Kip1 in human cerebellum tissue sections.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-p27 Kip1, clone 1B10 ZooMAb®, Cat. No. ZRB1429, is a recombinant Rabbit monoclonal antibody that detects p27 Kip1 and is tested for use in in Affinity Binding Assay, Immunocytochemistry, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Cyclin-dependent kinase inhibitor 1B (UniProt: P46527; also known as Cyclin-dependent kinase inhibitor p27, p27Kip1) is encoded by the CDKN1B (also known as KIP1) gene (Gene ID: 1027) in human. p27Kip1 is a member of the universal cyclin-dependent kinase inhibitor family that serves as an important regulator of cell cycle progression. It inhibits the kinase activity of CDK2 bound to cyclin A. Its expression is regulated by cell contact inhibition and by specific growth factors. p27Kip1 is shown to be essential for the establishment of a G1 check point arrest after DNA damage. Phosphorylation of p27Kip1 by ATM kinase leads to its stabilization following DNA double strand breaks. In addition to its role as a cyclin-dependent kinase inhibitor p27Kip1 also acts as a tumor suppressor, regulator of drug resistance in solid tumors, and promoter of apoptosis. In quiescent cells it localizes in nucleus and cytoplasm and its levels are high that decline rapidly after stimulation with mitogens. Phosphorylation on serine 10 is the major site of phosphorylation in resting cells that takes place at the G0-G1 phase and leads to protein stability and facilitates nuclear export. Akt or Rsk- mediated phosphorylation on threonine 197 increases its interaction with 14-3-3 protein and allows it to translocates to the cytoplasm and promotes cell cycle progression. When phosphorylated on tyrosine 88 and 80, p27Kip1 translocates to the nucleus. Its nuclear localization signal is localized in amino acids 153-169. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Lloyd, RV et al., (1999). Am. J. Pathol. 154(2): 313-323; Cassimere, EK et al., (2016). PLoS One. 11(9); e0162806).
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.ПараметрыQuality Level 200 biological source rabbit recombinant expressed in HEK 293 cells antibody form purified antibody antibody product type primary antibodies clone 1B10, recombinant monoclonal description recombinant, expressed in HEK 293 cells product line ZooMAb® form lyophilized mol wt calculated mol wt 22.07 kDa","observed mol wt ~30 kDa purified by using Protein A species reactivity human species reactivity (predicted by homology) monkey, mouse packaging antibody small pack of 25 µL enhanced validation recombinant expression application(s) affinity binding assay: suitable","immunocytochemistry: suitable","immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable","western blot: suitable isotype IgG epitope sequence N-terminus conjugate unconjugated Protein ID accession no. NP_004055, UniProt accession no. P46527, shipped in ambient storage temp. 2-8°C Узнать цену -
Anti-P2RX4 antibody produced in rabbit
Human Protein Atlas Number: HPA039494 Human Protein Atlas characterization data
Кат. номер HPA039494-100UL HPA039494-25UL Immunogenpurinergic receptor P2X, ligand-gated ion channel, 4 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST81062,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunoblotting: 0.04-0.4 µg/mL","immunofluorescence: 0.25-2 µg/mL","immunohistochemistry: 1:50-1:200 immunogen sequence YCMKKRLYYREKKYKYVEDYEQGLASELDQ conjugate unconjugated UniProt accession no. Q99571, shipped in wet ice storage temp. 20°C Gene Information human ... P2RX4(5025)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-P2RX7 antibody produced in rabbit
Human Protein Atlas Number: HPA034968 Human Protein Atlas characterization data
Кат. номер HPA034968-100UL HPA034968-25UL Immunogenpurinergic receptor P2X, ligand-gated ion channel, 7 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST77709,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation independent
orthogonal RNAseqapplication(s) immunoblotting: 0.04-0.4 µg/mL","immunohistochemistry: 1:500-1:1000 immunogen sequence CRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSR conjugate unconjugated UniProt accession no. Q99572, shipped in wet ice storage temp. 20°C Gene Information human ... P2RX7(5027)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-P2RY1 antibody produced in rabbit
Human Protein Atlas Number: HPA015577 Human Protein Atlas characterization data
Кат. номер HPA015577-100UL HPA015577-25UL ImmunogenP2Y purinoceptor 1 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
P2Y purinoceptor 1 is a protein encoded by the P2RY1 gene in humans. Expression of this gene plays an important role in ectopic bone formation in the spinal ligaments of posterior longitudinal ligament of the spine (OPLL) patients. Activation of its receptors induces cell death and inhibited growth of human prostatic carcinoma PC-3 cells. It may act as a novel and promising therapeutic strategy for prostate cancer. P2RY1 has been implicated in development of heart disease and is involved in platelet aggregation and thromboembolic diseases as well.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST72773,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50-1:200 immunogen sequence MKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDT conjugate unconjugated UniProt accession no. P47900, shipped in wet ice storage temp. 20°C Gene Information human ... P2RY1(5028)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-P2RY10 antibody produced in rabbit
Human Protein Atlas Number: HPA065766 Human Protein Atlas characterization data
Кат. номер HPA065766-100UL HPA065766-25UL Immunogenpurinergic receptor P2Y, G-protein coupled, 10ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST92595,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:500- 1:1000 immunogen sequence MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG conjugate unconjugated UniProt accession no. O00398, shipped in wet ice storage temp. 20°C Gene Information human ... P2RY10(27334)
Safety Informationpictograms GHS07 signalword Warning hcodes H315 - H319 pcodes P305 + P351 + P338 RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-P2RY13 antibody produced in rabbit
Human Protein Atlas Number: HPA049047 Human Protein Atlas characterization data
Кат. номер HPA049047-100UL HPA049047-25UL Immunogenpurinergic receptor P2Y, G-protein coupled, 13 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST78145,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLCПараметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:20- 1:50 immunogen sequence NTTVMQGFNRSERCPRDTRIVQLVF conjugate unconjugated UniProt accession no. Q9BPV8, shipped in wet ice storage temp. 20°C Gene Information human ... P2RY13(53829)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-P2RY8 antibody produced in rabbit
Human Protein Atlas Number: HPA003631 Human Protein Atlas characterization data
Кат. номер HPA003631-100UL HPA003631-25UL ImmunogenP2Y purinoceptor 8 recombinant protein epitope signature tag (PrEST)ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Biochem/physiol Actions
P2Y purinoceptor 8 is a protein encoded by the P2RY8 gene in humans. It increases both the trans-activation activities of CREB and Elk-1 as well as the transcriptional activities of the serum response element and enhancer-promoter fragments of the c-Fos and c-Myc genes. The gene expression is abundant in leukemic cells.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST74545,.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azideLegal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRPGLQRQESVF conjugate unconjugated UniProt accession no. Q86VZ1, shipped in wet ice storage temp. 20°C Gene Information human ... P2RY8(286530)
Safety InformationPersonal Protective Equipment Eyeshields,, Gloves,, multi-purpose combination respirator cartridge (US), RIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable Узнать цену -
Anti-p300 Antibody, clone 4E5 ZooMAb® Rabbit Monoclonal
Кат. номер ZRB1204-25UL ZRB1204-4X25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.
Specificity
Clone 4E5 a ZooMAb® Rabbit recombinant monoclonal antibody that detects Histone acetyltransferase p300. It targets an epitope within the N-terminal half.ImmunogenHis-tagged recombinant fragment corresponding to 233 amino acids from the N-terminal half of human Histone acetyltransferase p300.ApplicationQuality Control Testing
Evaluated by Immunocytochemistry in MCF-7 cells.
Immunocytochemistry Analysis: A 1:100 dilution of this antibody detected p300 in MCF-7 cells.
Tested applications
ELISA Analysis: 300 µg/mL from a representative lot detected p300 in an ELISA.
Affinity Binding Assay: A representative lot of this antibody bound p300 with a KD of 2 x 10-7 in an affinity binding assay.
Western Blotting Analysis: A 1:1,000 dilution of this antibody detected p300 in nuclear extracts from HeLa and NTERA2 cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-p300, clone 4E5 ZooMAb®, Cat. No. ZRB1204, is a recombinant Rabbit monoclonal antibody that detects p300 (Histone Acetyltransferase p300) and is tested for use Affinity Binding Assay, ELISA, Immunocytochemistry, and Western Blotting.
Target description
Histone acetyltransferase p300 (UniProt: Q09472; also known as EC:2.3.1.48, p300 HAT, E1A-associated protein p300, Histone butyryltransferase p300, Histone crotonyltransferase p300, Protein 2-hydroxyisobutyryltransferase p300, Protein propionyltransferase p300) is encoded by the EP300 (also known as P300) gene (Gene ID: 2033) in human. p300 serves as a transcriptional co-activator protein that plays a central role in coordinating and integrating multiple signal-dependent transcriptional events, such as cell proliferation, differentiation, and apoptosis. It has histone acetyltransferase (HAT) activity that transfers an acetyl group to the -amino group of multiple lysine residues. p300 localizes to active chromatin and acetylates all four core histones in nucleosomes, providing an epigenetic tag for transcriptional activation. It also shown to mediate cAMP-gene regulation by binding specifically to phosphorylated CREB protein. It mediates acetylation of histone H3 at lysine 122, a modification that localizes at the surface of the histone octamer and stimulates transcription, possibly by promoting nucleosome instability. It also mediates acetylation of histone H3 at lysine 27. It can also acetylase a number of non-histone targets, such as ALX1, HDAC1, PRMT1 or SIRT2. Its acetylation of HDAC1 is shown to lead to inactivation and modulation of transcription. p300 contains one TAZ-type 1 (aa 331-417), one TAZ-type 2 (aa 1728-1809), and one ZZ-type (aa 1664-1707) zinc finger domains. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals.
Physical form
Purified recombinant rabbit monoclonal antibody IgG, lyophilized in PBS with 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb® formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 µL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры
