- Главная
- Sigma-Aldrich
- Protein Biology
Каталог
Товары в наличии
- загружается список...
Производители
- загружается список...
Измерительные приборы
- загружается список...
Перемешивание и встряхивание
- загружается список...
Отбор проб и пробоподготовка
- загружается список...
Перегонка, разделение и фильтрование
- загружается список...
Нагревание и охлаждение
- загружается список...
Дозирование жидкостей
- загружается список...
Вакуумная техника
- загружается список...
Микроскопы и оптика
- загружается список...
Оборудование для очистки воды
- загружается список...
Оборудование для очистки, дезинфекции и стерилизации
- загружается список...
Анализ продуктов питания, воды и почв
- загружается список...
Микробиология и биотехнология
- загружается список...
Хроматография: приборы и принадлежности
- загружается список...
Расходные материалы для лабораторий
- загружается список...
Охрана труда и безопасность в лаборатории
- загружается список...
Оборудование для фармацевтических и пищевых производств
- загружается список...
Пилотное производство
- загружается список...
Лабораторная посуда
- загружается список...
Мебель лабораторная
- загружается список...
Тестеры контроля качества фармацевтических препаратов
- загружается список...
Sigma-Aldrich
Новинки
- загружается список...
Protein Biology
- Сортировать:
- Вид таблицей
-
Anti-PSD4 antibody produced in rabbit
Human Protein Atlas Number: HPA034723 Human Protein Atlas characterization data
Кат. номер HPA034723-100UL HPA034723-25UL Immunogenpleckstrin and Sec7 domain containing 4ApplicationAll Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org),and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols, and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige,.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
LinkageCorresponding Antigen APREST87087,.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.Legal InformationPrestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметрыbiological source rabbit Quality Level 100 antibody form affinity isolated antibody antibody product type primary antibodies clone polyclonal product line Prestige Antibodies® Powered by Atlas Antibodies form buffered aqueous glycerol solution species reactivity human packaging antibody small pack of 25 µL enhanced validation orthogonal RNAseq application(s) immunohistochemistry: 1:50- 1:200 immunogen sequence PGSPVNSHLPGSPKQNRSTSTQVVFWAGILQAQMCVLDLEEELEKTEGLKAGLKCCLPTPPVDLPGDTGLHSSPPENEDSGEDSSEPEGEGQAWLREGTPDSSPQW conjugate unconjugated UniProt accession no. Q8NDX1, shipped in wet ice storage temp. 20°C Gene Information human ... PSD4(23550)
Safety InformationRIDADR NONH for all modes of transport WGK Germany WGK 1 Flash Point F Not applicable Flash Point C Not applicable -
Anti-PSD95 Antibody, clone K28/43 ZooMAb® Mouse Monoclonal
Кат. номер ZMS1068-4X25UL ZMS1068-25UL General descriptionZooMAb® antibodies represent an entirely new generation of recombinant monoclonal antibodies.
Each ZooMAb® antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and precisely dispensed to produce robust and highly reproducible lot-to-lot consistency. Only top-performing clones are released for use by researchers. Each antibody is validated for high specificity and affinity across multiple applications, including its most commonly used application. ZooMAb® antibodies are reliably available and ready to ship when you need them.SpecificityClone K28/43 is a ZooMAb® mouse recombinant monoclonal antibody that specifically detects Postsynaptic density protein 95. It targets an epitope within PDZ domains 1 and 2.ImmunogenFusion protein corresponding to 223 amino acids from N-terminal half of human PSD-95.ApplicationQuality Control Testing
Evaluated by Western Blotting in Mouse brain tissue lysate.
Western Blotting Analysis: A 1:50,000 dilution of this antibody detected PSD95 in Mouse brain tissue lysate.
Tested applications
Western Blotting Analysis: A 1:50,000 dilution from a representative lot detected PSD95 in Rat Brain, Human Brain, Human Hippocampus Membrane, Mouse Brain Membrane, Rat Brain Microsomes, and SH-SY5Y cell lysates.
Immunohistochemistry (Paraffin) Analysis: A 1:100 dilution from a representative lot detected PSD95 in rat brain tissue sections.
Immunofluorescence Analysis: A 1:100 dilution from a representative lot detected PSD95 in rat brain tissue sections.
Flow Cytometry Analysis: 1 µg from a representative lot detected PSD95 in one million SH-SY5Y cells.
Note: Actual optimal working dilutions must be determined by end user as specimens, and experimental conditions may vary with the end user
Anti-PSD95, clone K28/43 ZooMAb®, Cat. No. ZMS1068, is a recombinant Mouse monoclonal antibody that targets PSD95 and is tested for use in in Flow Cytometry, Immunofluorescence, Immunohistochemistry (Paraffin), and Western Blotting.
Target description
Disks large homolog 4 (UniProt: P78352; also known as Postsynaptic density protein 95, PSD-95, Synapse-associated protein 90, SAP-90, SAP90) is encoded by the DLG4 (also known as PSD95) gene (Gene ID: 1742) in human. PSD-95 is a postsynaptic scaffolding protein that plays a critical role in synaptogenesis and synaptic plasticity by providing a platform for the postsynaptic clustering of crucial synaptic proteins. High levels of PSD-95 are observed in postsynaptic density of neurons in the forebrain. It is also present in the presynaptic region of inhibitory synapses formed by cerebellar basket cells on axon hillocks of Purkinje cells. It interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. It is required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 gene is reported to change the ratio of excitatory to inhibitory synapses in hippocampal neurons. PSD-95 undergoes palmitoylation by DHHC-type palmitoyltransferase 2 (ZDHHC2), which is required for targeting to postsynaptic density, plasma membrane and synapses. Palmitoylation may play a role in glutamate receptor GRIA1 synapse clustering. PSD-95 is reported to undergo rapid synaptic palmitoylation/depalmitoylation cycles during neuronal development. This ZooMAb® recombinant monoclonal antibody, generated by our propriety technology, offers significantly enhanced specificity, affinity, reproducibility, and stability over conventional monoclonals. (Ref.: Jeong, J., et al. (2019). Proc. Natl. Acad. Sci. USA. 116(24); 12035-12044).
Physical form
Purified recombinant mouse monoclonal antibody IgG, lyophilized in PBS, 5% Trehalose, normal appearance a coarse or translucent resin. The PBS/trehalose components in the ZooMAb formulation can have the appearance of a semi-solid (bead like gel) after lyophilization. This is a normal phenomenon. Please follow the recommended reconstitution procedure in the data sheet to dissolve the semi-solid, bead-like, gel-appearing material. The resulting antibody solution is completely stable and functional as proven by full functional testing. Contains no biocide or preservatives, such as azide, or any animal by-products. Larger pack sizes provided as multiples of 25 μL.
Reconstitution
300 μg/mL after reconstitution at 25 μL per vial. Please refer to guidance on suggested starting dilutions and/or titers per application and sample type.
Storage and Stability
Recommend storage of lyophilized product at 2-8°C; Before reconstitution, micro-centrifuge vials briefly to spin down material to bottom of the vial; Reconstitute each vial by adding 25 μL of filtered lab grade water or PBS; Reconstituted antibodies can be stored at 2-8°C, or -20°C for long term storage. Avoid repeated freeze-thaws.Legal InformationZooMAb is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.Параметры